DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5909 and CG43336

DIOPT Version :9

Sequence 1:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:273 Identity:97/273 - (35%)
Similarity:139/273 - (50%) Gaps:23/273 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 LQLLNSV----TNCGNKGN----PKVSGGKTARPGDFPWVALLKYKINDPRPFRCGGSLISERHI 169
            |.||.|.    ..||.:.:    |:|..|..|.....||:|.|  ...|.| |.||||||:.|.:
  Fly    13 LPLLGSTQFLDMACGIRAHSPSVPRVKNGTVASLTSSPWMAFL--HSTDGR-FICGGSLITNRLV 74

  Fly   170 LTAAHCIIDQPEVIAVRLGEHDLESEEDCHYLGGTNRVCIPPYEEYGIEQIRVHPNYVHGKISHD 234
            ||||||.:|:.|::| ||||:|.|..|.||....|.|:      |..:|:...|.:|....:::|
  Fly    75 LTAAHCFLDRTELVA-RLGEYDREEYEMCHDSYCTYRI------EAMVERGFRHRHYNPMTMAYD 132

  Fly   235 VAIIKLDRVVKEKSHIKPVCLPIDQKSQE-LDFDQSFFVAGWGGTEKETVATKLQQALITRKSLN 298
            :||::|.|.|:...:|:|:|:.||.:.:: :|........|||.||.|..:.||:...:.||...
  Fly   133 IAILRLYRKVQYTDNIRPICIVIDPRWRKYIDSLDPLTGTGWGKTESEGDSAKLRTVDLARKHPE 197

  Fly   299 ECRQYYNKGEVSDNHICATGTGIKHTCQGDSGGPVFFKHRFKNTYRVVQYGVVSFGGRLCGQNQP 363
            .||:|... .::.|..|| |....:.|.|||||||.....:..:.|.||.|:.||....|  ...
  Fly   198 VCRRYATL-SLTANQFCA-GNERSNLCNGDSGGPVGALIPYGKSKRFVQVGIASFTNTQC--VMV 258

  Fly   364 GVFASVIDMLPWI 376
            .||..|:..:.||
  Fly   259 SVFTDVMSYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5909NP_651544.1 CLIP 25..82 CDD:197829
Tryp_SPc 129..376 CDD:214473 88/247 (36%)
Tryp_SPc 132..379 CDD:238113 89/246 (36%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 88/247 (36%)
Tryp_SPc 40..271 CDD:238113 87/244 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.