DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5909 and CG43110

DIOPT Version :9

Sequence 1:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:261 Identity:75/261 - (28%)
Similarity:116/261 - (44%) Gaps:40/261 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 CGNKGNPKVSGGKTARPGDFPWVALLKYKINDPRPFRCGGSLISERHILTAAHCIIDQPEVIAVR 186
            ||....||:..|..|......::|    .|.:.....|||::|.|..:||.|||  ...:.:.||
  Fly    28 CGKTPVPKIISGSNASQQSAQYMA----GIFNTTHLLCGGTIIHEDFVLTVAHC--KSTQTLFVR 86

  Fly   187 LGEHDLESEEDCHYLGGTNRVCIPPYEEYGIEQIRV-----HPNYVHGKISHDVAIIKLDRVVKE 246
            ||.:::....|                     ||||     ||.|.:...::|:|::||:|.|..
  Fly    87 LGAYNINHPTD---------------------QIRVIETIAHPQYSNSTYANDIALVKLERSVIF 130

  Fly   247 KSHIKPVCLPIDQK-SQELDFDQSFFVAGWGGTEKETVATKLQQALITRKSLNECRQYYNKGEVS 310
            ..:|:|:|:.:|.. .:::.:..:|   |||.|.....:..||:..:.|.:...|..|..... .
  Fly   131 NLNIQPICIHLDATLGKQIRYYNAF---GWGRTRNAEQSDILQRIFVNRTNPMICHLYLGMSP-D 191

  Fly   311 DNHICATGTGIKHTCQGDSGGPVFFKHRFKNTYRVVQYGVVSFGGRLCGQNQPGVFASVIDMLPW 375
            ...|||| |....||.||||||:..|..::......|:|:.|:|.|.|  |..|::..|.....|
  Fly   192 PKQICAT-TDQGDTCAGDSGGPLISKITYQGKNFDTQFGITSYGTREC--NGVGLYTDVSQYSGW 253

  Fly   376 I 376
            |
  Fly   254 I 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5909NP_651544.1 CLIP 25..82 CDD:197829
Tryp_SPc 129..376 CDD:214473 70/252 (28%)
Tryp_SPc 132..379 CDD:238113 71/251 (28%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 70/252 (28%)
Tryp_SPc 36..257 CDD:238113 71/253 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.