DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and Prss41

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001128559.1 Gene:Prss41 / 681033 RGDID:1584711 Length:324 Species:Rattus norvegicus


Alignment Length:297 Identity:88/297 - (29%)
Similarity:137/297 - (46%) Gaps:55/297 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 KVMSLFKDENFDCG--NFLSQRVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTA 161
            |::|:      .||  |.:..|:..|.|......||.|.||.::|..    |||:::|.|::|||
  Rat    39 KLLSM------PCGRRNDIRSRIVGGIESVRGRWPWQASLRLRKFHR----CGGSLLSHRWVLTA 93

  Fly   162 AHCVHG-LQNDLYEIRLGEHRISTEEDCRQ--QGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHD 223
            |||... |....:.::||:.........|:  .||.:          ::..:|:.:...::  ||
  Rat    94 AHCFRKFLDPKKWTVQLGQLTSKPSFWNREAFSGRYR----------VKDIIINSEDKLKY--HD 146

  Fly   224 IALLKLNRSVPFQKHIKPICLPITDELKEKAEQISTYFVTGWGTTENGSSSDV--------LLQA 280
            :|||:|..||.:.|.|:|:|:..:..:.:...:.   :|||||..:    .|:        |.:.
  Rat   147 LALLRLASSVTYNKFIQPVCVLPSASMSQHQPRC---WVTGWGALQ----EDLKPLPPPYHLREV 204

  Fly   281 NVPLQPRSACSQAYRRA-----VPLSQLCVGGGD-LQDSCKGDSGGPLQAPAQYLGEYAPKMVEF 339
            .|.:...|.|.:.:..|     :.....|.|..| ..|:|.|||||||......|      ..:.
  Rat   205 QVTVLNLSRCQELFSFASRYHLITRDVFCAGAEDGSADTCSGDSGGPLVCNMDGL------WYQI 263

  Fly   340 GIVSQGVVTCGQISLPGLYTNVGEYVQWITDTMASNG 376
            ||||:| |.||:..|||:||||..:..||...|..||
  Rat   264 GIVSRG-VGCGRPKLPGIYTNVSHHYDWIKTMMILNG 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 79/266 (30%)
Prss41NP_001128559.1 Tryp_SPc 54..291 CDD:214473 78/266 (29%)
Tryp_SPc 55..292 CDD:238113 78/266 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.