DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and PRSS22

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_071402.1 Gene:PRSS22 / 64063 HGNCID:14368 Length:317 Species:Homo sapiens


Alignment Length:264 Identity:74/264 - (28%)
Similarity:125/264 - (47%) Gaps:40/264 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 RVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVHGLQND--LYEIRLGEH 180
            ||..|.:...|..||  ::..|:.|...  |.|::::.|:::|||||.....|.  |:.:.||..
Human    49 RVVGGEDSTDSEWPW--IVSIQKNGTHH--CAGSLLTSRWVITAAHCFKDNLNKPYLFSVLLGAW 109

  Fly   181 RISTEEDCRQQGRKKKCAPPVVNVG-IEKHLIHEKYDARHIMHDIALLKLNRSVPFQKHIKPICL 244
            ::.......|:          |.|. :|.|.::...:.  ...||||::|.||:.|.:.:.||||
Human   110 QLGNPGSRSQK----------VGVAWVEPHPVYSWKEG--ACADIALVRLERSIQFSERVLPICL 162

  Fly   245 PITDELKEKAEQISTYFVTGWGTTENG---SSSDVLLQANVPLQPRSACSQAYRRAV---PLSQ- 302
            |   :........:..:::|||:.::|   .....|.:..||:.....||..|.|..   |::: 
Human   163 P---DASIHLPPNTHCWISGWGSIQDGVPLPHPQTLQKLKVPIIDSEVCSHLYWRGAGQGPITED 224

  Fly   303 -LCVG--GGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVVTCGQISLPGLYTNVGEY 364
             ||.|  .|: :|:|.|||||||.  .|..|.:    :..||:|.| ..|.:.:.||:|.::..:
Human   225 MLCAGYLEGE-RDACLGDSGGPLM--CQVDGAW----LLAGIISWG-EGCAERNRPGVYISLSAH 281

  Fly   365 VQWI 368
            ..|:
Human   282 RSWV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 72/261 (28%)
PRSS22NP_071402.1 Tryp_SPc 50..288 CDD:238113 73/263 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.