DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and si:dkeyp-93a5.3

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_021326347.1 Gene:si:dkeyp-93a5.3 / 571565 ZFINID:ZDB-GENE-131127-100 Length:328 Species:Danio rerio


Alignment Length:295 Identity:83/295 - (28%)
Similarity:125/295 - (42%) Gaps:68/295 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 CGN---FLSQRVSNGYEVKLSSRPWMALL--RYQQFGESRFLCGGAMISERYILTAAHCVHGLQN 170
            ||.   .|:.|:..|......:.|||..|  ||..|      |||::|:.:::||||||:.....
Zfish    25 CGRPNPTLNPRIVGGVNATHGAWPWMVSLQGRYGHF------CGGSLINNQWVLTAAHCIVDQTP 83

  Fly   171 DLYEIRLGEHRISTEEDCRQQGRKKKCAPPVVNVGIEKHLI-HEKYDARHIMHDIALLKLNRSVP 234
            ....:.||:.| |...|.....|            ..:|:| |..|......:|||||:|..:|.
Zfish    84 SSIIVYLGKWR-SYVADVNSISR------------TIRHIIPHPSYSNITKDNDIALLQLTSTVQ 135

  Fly   235 FQKHIKPICLPITDELKEKAEQISTY------FVTGWG-------------TTENG--SSSDVLL 278
            :..:||||||         |::.|.:      :|.|||             ||.:.  ....:|.
Zfish   136 YTDYIKPICL---------ADENSNFPRGTNSWVAGWGDIGVLGTGGIRGRTTVSVPLPHPGILQ 191

  Fly   279 QANVPLQPRSACSQAYRRAVPLSQLCVG---GGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFG 340
            :|.:.:...:.|:......:..:.:|.|   ||  :.:..|||||||......       .|:.|
Zfish   192 EAELKVYSNADCNNICHGRITPNMICAGTRPGG--KATFSGDSGGPLMTKCSV-------WVQAG 247

  Fly   341 IVSQGVVTCGQISLPGLYTNVGEYVQWITDTMASN 375
            ::|.| ..|.|.:||.::..|.||.||||..:..|
Zfish   248 VLSHG-YGCAQPNLPEVFIRVSEYKQWITGNVGGN 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 78/276 (28%)
si:dkeyp-93a5.3XP_021326347.1 Tryp_SPc 36..274 CDD:238113 75/275 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.