DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and Prss33

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001102497.1 Gene:Prss33 / 497873 RGDID:1583742 Length:277 Species:Rattus norvegicus


Alignment Length:274 Identity:80/274 - (29%)
Similarity:121/274 - (44%) Gaps:43/274 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 CGN-FLSQRVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCV--HGLQNDL 172
            ||. .:|.|:..|.:.:....||...::::    ...:|||::|:.:::|||.||.  ..|.:: 
  Rat    25 CGQPRMSSRIVGGRDAQDGEWPWQTSIQHR----GAHVCGGSLIAPQWVLTAGHCFSRRVLPSE- 84

  Fly   173 YEIRLGEHRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLKLNRSVPFQK 237
            |.:.||...:....       ..:...||:.|     |:...|.......|:|||:|:..|....
  Rat    85 YSVLLGALSLDVTS-------SHELLVPVLRV-----LLPPDYSEDEARGDLALLQLSHPVSLSA 137

  Fly   238 HIKPICLPITDELKEKAEQISTYFVTGWGTTENG---SSSDVLLQANVPLQPRSACSQAYRRA-- 297
            .|:|:|||.........   |..:|||||:...|   .....|....|||....||.:.|...  
  Rat   138 RIQPVCLPAPGSHPPPG---SPCWVTGWGSLSPGVPLPKGRPLQGVRVPLLDSRACDRLYHMGAN 199

  Fly   298 VPLSQLCVGGGDL--------QDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVVTCGQISL 354
            ||.|:..|..|:|        :|:|:|||||||....      :.:.|..|:||.| ..|...:.
  Rat   200 VPKSERIVLPGNLCAGYRRGHKDACQGDSGGPLTCME------SGRWVLVGVVSWG-KGCALPNR 257

  Fly   355 PGLYTNVGEYVQWI 368
            ||:||||.:|..||
  Rat   258 PGVYTNVAKYSPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 76/263 (29%)
Prss33NP_001102497.1 Tryp_SPc 33..271 CDD:214473 75/264 (28%)
Tryp_SPc 34..272 CDD:238113 76/265 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.