DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and CG11313

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:393 Identity:119/393 - (30%)
Similarity:177/393 - (45%) Gaps:58/393 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 AVLYGIAIVSSMGVQSARADYADDCTTPDGDQGQCMPFSSCRTIEERLTEAQKAGQKVPADYASY 72
            |||..:.|     :::|...|. .|..|:...|.|:....|..:...|.::.....::     .:
  Fly     6 AVLLCLLI-----IRTAHGQYV-SCRNPNQRTGYCVNIPLCVPLNSVLAKSNPTDSEM-----RF 59

  Fly    73 LQKALC--GEFNGVRHFCC------------PSANIQHNSKVMSLFKDENFDCGNFLSQRVSNGY 123
            ::::.|  .:.:.:...||            |:..:.|:    :|..|.:...|:....:::.|.
  Fly    60 IRESRCLVSDQSDLPFVCCTPDTDYNTTRARPNDEVIHS----TLLPDRSICGGDIAYNQITKGN 120

  Fly   124 EVKLSSRPWMALLRYQQFG--ESRFLCGGAMISERYILTAAHCV----HGLQNDL---YEIRLGE 179
            |..|:...||.||.|:...  :.|..|.|::|:.||::||||||    ...:.|:   ..:||||
  Fly   121 ETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSVRLGE 185

  Fly   180 HRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLKLNRSVPFQKHIKPICL 244
            |..|...|| ..||   |.|..|.:.:|:..|||.:..|...:||||::|.|.|.:...|:|:||
  Fly   186 HNTSAVVDC-LNGR---CLPEPVQIAVEEIRIHESFGTRLFWNDIALIRLAREVAYSPSIRPVCL 246

  Fly   245 PITDELKEKAEQISTYFVTGWGTTENGSSSDVLLQANVPLQPRSACSQAYRRAVPL--SQLCVGG 307
            |.|..| :..:....:.|.|||.|....||.|.::..|.......|.:.|...|.|  |.||..|
  Fly   247 PSTVGL-QNWQSGQAFTVAGWGRTLTSESSPVKMKLRVTYVEPGLCRRKYASIVVLGDSHLCAEG 310

  Fly   308 GDLQDSCKGDSGGPLQA---PAQYLGEYAPKMVEFGIVSQGVVTCGQISLPGLYTNVGEYVQWIT 369
            ....|||.|||||||.|   ....||         ||||.| :.||....|.:||||..|..|||
  Fly   311 RSRGDSCDGDSGGPLMAFHEGVWVLG---------GIVSFG-LNCGSRFWPAVYTNVLSYETWIT 365

  Fly   370 DTM 372
            ..:
  Fly   366 QNI 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829 9/71 (13%)
Tryp_SPc 121..371 CDD:238113 99/263 (38%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855 7/58 (12%)
Tryp_SPc 116..367 CDD:238113 99/265 (37%)
Tryp_SPc 116..364 CDD:214473 96/262 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.