DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and CG16710

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:381 Identity:118/381 - (30%)
Similarity:170/381 - (44%) Gaps:92/381 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 QCMPFSSCRTI-----EERLTEAQKAGQKVPAD-YASY-------LQKALCGEFNGVRHFCCPS- 91
            :|:..:.|.::     ...:|.|:||   |..| |..|       |.:.|         .|||: 
  Fly    35 KCISLARCTSLLPFLKPHNMTPAEKA---VFEDRYCGYGPKGQELLDRVL---------ICCPNM 87

  Fly    92 ANIQHNSKVMSLFKDENFDCGNFL-SQRVSNGYEVKLSSRPWMALLRYQQFGES----RFL--CG 149
            .:|..|:::          ||..: :.|:..|.|.:.:..|||||:.|.....|    |.:  |.
  Fly    88 GHILPNTQI----------CGPIMPAYRIFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCA 142

  Fly   150 GAMISERYILTAAHCVHGLQNDLYEIRLGEHRISTEEDC--RQQGRKKKCAPPVVNVGIEKHLIH 212
            |::|:.||:||||||:.....||..:|||||.|.:..||  ...|| :.|||..:.:.::..:.|
  Fly   143 GSLITNRYVLTAAHCLRITGLDLRRVRLGEHNILSNPDCVTHINGR-EHCAPEHLEIDVDLSIKH 206

  Fly   213 EKYDARHIM-------HDIALLKLNRSVPFQKHIKPICLPITDELKEKAEQISTYFVTGWGTTEN 270
                 ||.|       :|||||:|...|.:...|||||:.:.......:.......:.|||.:..
  Fly   207 -----RHYMVFEERPYNDIALLRLKFPVRYTAQIKPICVQLDYIFSNPSFSNHKLQIAGWGLSHK 266

  Fly   271 GSSSDVLLQANVPLQPRSACSQAYRRAVPLSQ----------LCVG--GGDLQDSCKGDSGGPLQ 323
            ...|:|||||.|..:....||        ||:          :|.|  ||:  |:|||||||||.
  Fly   267 QGYSNVLLQAYVNGRNADECS--------LSEPSLGLDKETHICAGNLGGN--DTCKGDSGGPLM 321

  Fly   324 APAQYLGEYAPKMVEF----GIVSQGVVTCGQISLPGLYTNVGEYVQWITDTMASN 375
            |..:...|      ||    ||.|.|...||.  .|..||...::|:||...|.:|
  Fly   322 AIMERGDE------EFVYLAGITSYGYSQCGY--GPAAYTKTSKFVEWILWNMYTN 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829 13/61 (21%)
Tryp_SPc 121..371 CDD:238113 96/280 (34%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855 12/60 (20%)
Tryp_SPc 105..362 CDD:214473 95/280 (34%)
Tryp_SPc 106..362 CDD:238113 94/279 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.