Sequence 1: | NP_651543.1 | Gene: | grass / 43273 | FlyBaseID: | FBgn0039494 | Length: | 377 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001361838.1 | Gene: | D1081.3 / 42101339 | WormBaseID: | WBGene00008381 | Length: | 340 | Species: | Caenorhabditis elegans |
Alignment Length: | 196 | Identity: | 45/196 - (22%) |
---|---|---|---|
Similarity: | 80/196 - (40%) | Gaps: | 65/196 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 150 GAMISERYILTAAHCV-HGLQNDLYEIRLGEHR--------------ISTEE----------DCR 189
Fly 190 QQG---RKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLKLNRSVPFQKHIKPICLPITDELK 251
Fly 252 EKAEQISTY--FVTGWGTTENGSSSDVLLQANVPLQPRSA--------CSQAYR----RAVPLSQ 302
Fly 303 L 303 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
grass | NP_651543.1 | CLIP | 32..90 | CDD:197829 | |
Tryp_SPc | 121..371 | CDD:238113 | 45/196 (23%) | ||
D1081.3 | NP_001361838.1 | DUF316 | <15..228 | CDD:367641 | 45/196 (23%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |