DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and D1081.3

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001361838.1 Gene:D1081.3 / 42101339 WormBaseID:WBGene00008381 Length:340 Species:Caenorhabditis elegans


Alignment Length:196 Identity:45/196 - (22%)
Similarity:80/196 - (40%) Gaps:65/196 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 GAMISERYILTAAHCV-HGLQNDLYEIRLGEHR--------------ISTEE----------DCR 189
            |..||.|::||:|..: .|.:|  :.|...:.:              |..||          :|.
 Worm    15 GFFISPRHVLTSAFSILTGARN--WRINYNKEQVFKTLEYIKDTLSAIIPEEVTKNMKVIPGNCS 77

  Fly   190 QQG---RKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLKLNRSVPFQKHIKPICLPITDELK 251
            ...   :.||..  ::||.      .::.|..: |..:.|::|      ::::|.|..|...  :
 Worm    78 SSQCYLKPKKAV--LINVK------EQEVDFDN-MFALVLIEL------EENVKNISFPCVG--R 125

  Fly   252 EKAEQISTY--FVTGWGTTENGSSSDVLLQANVPLQPRSA--------CSQAYR----RAVPLSQ 302
            :.:|.|..|  |:.|:.||:|.:|:   ||. :||:.|..        |:..|:    |..||.:
 Worm   126 KHSEVIDEYDVFLYGYDTTKNVTST---LQF-LPLKVREVKKNSRKWICTNKYQKMQDRGEPLVK 186

  Fly   303 L 303
            |
 Worm   187 L 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 45/196 (23%)
D1081.3NP_001361838.1 DUF316 <15..228 CDD:367641 45/196 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.