DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and CG3505

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:388 Identity:115/388 - (29%)
Similarity:171/388 - (44%) Gaps:65/388 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IAIVSSMGVQSARADYAD-DCTT--PDGD-QGQCMPFSSCRTIEERLTEAQKAGQKVPADYASYL 73
            :.:|.|:.: .|.|.... :|..  |.|. .|.|:....|    :.......:|....:| .:.|
  Fly     8 LVVVGSLAL-GANAQLPPINCVAKIPSGRVTGHCISIREC----DYFMRILLSGNLSQSD-RNLL 66

  Fly    74 QKALCGEFNGVRHFCCPS----ANIQHNSKVMSLFKDENFDCGNFLSQRVSNGYEVKLSSRPWMA 134
            :...||........||||    ..:.|     .|...   |||....|| ||..:.::...||:|
  Fly    67 RDNQCGVRGNDVQVCCPSTAGLGALTH-----PLLPS---DCGKVRWQR-SNDTDTRIREFPWLA 122

  Fly   135 LLRYQQFGESRF-LCGGAMISERYILTAAHCV-----HGLQNDLYEIRLGEHRISTEEDCR--QQ 191
            |:.|.:..:.:. .|||.:||:||:|||||||     ..||  :..:||||...||..||:  :.
  Fly   123 LIEYTRGNQEKIHACGGVLISDRYVLTAAHCVAQAATSNLQ--ITAVRLGEWDTSTNPDCQYHED 185

  Fly   192 GRKKKCAPPVVNVGIEKHLIHEKYDA--RHIMHDIALLKLNRSVPFQKHIKPICLP----ITDEL 250
            .:...||||..::.||:.|.|..|:.  |..::||||::|.........::|||||    ..|||
  Fly   186 SKVADCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLPNKQLRADEL 250

  Fly   251 KEKAEQISTYFVTGWGTTENGSSSDVLLQANVPLQPRSACSQAY---RRAVPLSQLCVGGGDLQD 312
            ::...:     |.||    ..|||..:.:..|.:.....|.:.|   :..:..|:||  |.....
  Fly   251 EDLVTE-----VAGW----QASSSQRMRKGYVTISSIEECQRKYASQQLRIQASKLC--GLTNSQ 304

  Fly   313 SCKGDSGGPL---QAPAQYLGEYAPKMVEFGIVSQGVVTCGQISLPGLYTNVGEYVQWITDTM 372
            .|.|::||||   :.....||         |:||.|.|.|.....|.:||.|..|:.||.|::
  Fly   305 ECYGNAGGPLMLFKNDGYLLG---------GLVSFGPVPCPNPDWPDVYTRVASYIDWIHDSL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829 12/60 (20%)
Tryp_SPc 121..371 CDD:238113 87/269 (32%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855 10/56 (18%)
Tryp_SPc 111..356 CDD:238113 86/266 (32%)
Tryp_SPc 111..354 CDD:214473 84/264 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.