DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and CG8870

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:309 Identity:92/309 - (29%)
Similarity:145/309 - (46%) Gaps:41/309 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 GVRHFCCP--SANIQHNSKVMSLFKDENFDCGNFLSQRVSNGYEVKLSSRPWMALLRYQQFGESR 145
            |....|||  ...:.|::            ||. ..::.:.|....|:..||||:|.|   |...
  Fly    59 GTNKVCCPKWETYLPHDT------------CGQ-SRRKPTKGKIPALNEFPWMAMLLY---GNKN 107

  Fly   146 FL-------CGGAMISERYILTAAHCVHGLQND----LYEIRLGEHRISTEEDCRQQGRKKKCAP 199
            .|       |||::|:..|:|||||||.....|    |..:|||||..||..|......:::.||
  Fly   108 NLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAP 172

  Fly   200 PVVNVGIEKHLIHEKYD-ARHIMHDIALLKLNRSVPFQKHIKPICLPITDELKEKAEQISTYFVT 263
            ..:.:.:::.:.||::: .|.:::||||::|...|.:.:.|:|||||...:|   |.....:..:
  Fly   173 LYMEIEVDQIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPICLPRAQKL---AAHKRKFQAS 234

  Fly   264 GWGTTENGSSSDVLLQANVPLQPRSACSQAYRRAVPLSQLCVGGGDLQDSCKGDSGGPLQAP--- 325
            ||.....|.:|:|||::.:..:....|...|...:. ||:|.||.|..|:..|||||||...   
  Fly   235 GWPDMGQGIASEVLLRSFIAERHPDVCKSNYDFNLG-SQICAGGLDGNDTSPGDSGGPLMETVIR 298

  Fly   326 AQYLGEYAPKMVEFGIVSQGVVTCGQISLPGLYTNVGEYVQWITDTMAS 374
            .:....||..::.:|.....:.||    .|..||....:.:||...:.|
  Fly   299 GKVTLTYAAGIISYGQKPCVLKTC----KPAFYTKTSYFFEWIKSKLQS 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829 2/6 (33%)
Tryp_SPc 121..371 CDD:238113 84/264 (32%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 82/257 (32%)
Tryp_SPc 93..337 CDD:214473 80/254 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.