DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and MP1

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:408 Identity:133/408 - (32%)
Similarity:194/408 - (47%) Gaps:78/408 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 MGVQSARADYADD----CTTPDGDQGQCMPFSSCRTIEERLTEAQKAGQKVPADYASYLQKALCG 79
            ||..|.   ||.:    |.|||.:.|.|:....|..:.|.|     ..::|......:||.:.||
  Fly    15 MGTSST---YAQEIFGYCRTPDENSGTCINLRECGYLFELL-----QSEEVTEQDRRFLQASQCG 71

  Fly    80 EFNG---VRHF-------CCPSANIQH---------------------NSKVMSLFKDENFDCGN 113
            ..||   .:||       ||.::.:::                     .:|::.:..    :||.
  Fly    72 YRNGQVLEKHFCFTNVQICCANSRMRNQQPQWGNHPQPTQTTKPTKRSGTKLLPMAP----NCGE 132

  Fly   114 FLSQRVSNGYEVKLSSRPWMALLRYQQFGESR-FLCGGAMISERYILTAAHCVHGLQND--LYEI 175
            ....||..|.|......|||||:.|.:.|..: ..|||::|:.||:|||||||..:.:|  |..:
  Fly   133 NFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDWELTGV 197

  Fly   176 RLGEHRISTEEDCR--QQGRKKKCAPPVVNVGIEKHLIHEKY--DARHIMHDIALLKLNRSVPFQ 236
            ||||...||..||.  :.|| :.|..|.|:..:|:.:.|.:|  ::|..::|||||:|...|.:.
  Fly   198 RLGEWDASTNPDCTVGKNGR-RDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQYS 261

  Fly   237 KHIKPICLPITDELKEKAEQISTYF------VTGWGTTENGSSSDVLLQANVPLQPRSACSQAY- 294
            ..|.|:|||..      |.|.:..|      |.|||.||...:|::.|:|.:...|.|.|:|.| 
  Fly   262 DFILPVCLPTL------ASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAELDTVPTSECNQRYA 320

  Fly   295 --RRAVPLSQLCVGGGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEF---GIVSQGVVTCGQISL 354
              ||.|...|:|.||.:..|||:|||||||     .|.:|:.....:   |:||.|...||....
  Fly   321 TQRRTVTTKQMCAGGVEGVDSCRGDSGGPL-----LLEDYSNGNSNYYIAGVVSYGPTPCGLKGW 380

  Fly   355 PGLYTNVGEYVQWITDTM 372
            ||:||.|..|:.||.:.:
  Fly   381 PGVYTRVEAYLNWIENNV 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829 19/67 (28%)
Tryp_SPc 121..371 CDD:238113 103/268 (38%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855 18/66 (27%)
Tryp_SPc 137..394 CDD:214473 103/268 (38%)
Tryp_SPc 138..397 CDD:238113 104/270 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.