DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and CG30414

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:287 Identity:85/287 - (29%)
Similarity:136/287 - (47%) Gaps:47/287 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 CG----NFLSQRVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVHGLQND 171
            ||    .|:.. ::.|.:..|.|.|||.    :..||.  ||||::|:.|::||||||:....  
  Fly    30 CGTTKPEFIPM-ITGGADAGLFSNPWMV----KVLGEK--LCGGSLITSRFVLTAAHCIVSTH-- 85

  Fly   172 LYEIRLGEHRIS---------------------TEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKY 215
             ..:||||::..                     .|.|.|..| |..|.|....:.:::.::|..|
  Fly    86 -MRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPG-KDCCVPKSYELAVDRKILHADY 148

  Fly   216 DARHIMHDIALLKLNRSVPFQKHIKPICLPITDELKEKAEQISTYFVTGWGTTENGSSSDVLLQA 280
            :. ::.:||.||::...|.:..:::||||.:...:.|.    ..:.:||||.|.:|:.|..|.:|
  Fly   149 NL-NLDNDIGLLRMKSFVQYSDYVRPICLLVEGHMAES----PIFNITGWGVTNDGTPSRRLQRA 208

  Fly   281 NVPLQPRSACSQAYRRAVPLSQLCVGGGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQG 345
            .|.......|...:.:.|..||:|..|.: .|:|.|||||||.|...:.|.:.  ..::|:||.|
  Fly   209 TVYNTDLHFCRSKFTKQVDESQICAAGTN-SDACHGDSGGPLSAQVPFAGSWL--TFQYGLVSYG 270

  Fly   346 VVTCGQISLPGLYTNVGEYVQWITDTM 372
            ...|...|   :||||..:..||.:.:
  Fly   271 SAACHSFS---VYTNVTHHRDWIVNAI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 82/270 (30%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 80/269 (30%)
Tryp_SPc 41..290 CDD:238113 80/269 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.