DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and CG30283

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:270 Identity:83/270 - (30%)
Similarity:138/270 - (51%) Gaps:43/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 CGNF-LSQ-RVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVHGLQNDLY 173
            ||.. :|| ::..|:...::|.||||::    .||..|.|||.:|:.|::||:|||:   .|...
  Fly    33 CGTVPISQFKILGGHNAPVASAPWMAMV----MGEGGFHCGGTLITNRFVLTSAHCI---ANGEL 90

  Fly   174 EIRLGEHRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKY--DARHIMHDIALLKLNRSVPFQ 236
            ::|||    ..|.:...|           ...::...:|..|  |    .||:|||:|.:.|.:.
  Fly    91 KVRLG----VLEREAEAQ-----------KFAVDAMFVHTDYYFD----QHDLALLRLAKRVHYS 136

  Fly   237 KHIKPICL---PITDELKEKAEQISTYFVTGWGTTENGSSSDVLLQANVPLQPRSACSQAY-RRA 297
            .:|.||||   |:...:.|...:..||   |||.||:.|||.:|.:.::....||.|::.| .:.
  Fly   137 DNISPICLLLDPLVKNIDEHIVKFRTY---GWGKTESRSSSRMLQKTSLFNLHRSECAKQYPHQQ 198

  Fly   298 VPLSQLCVGGGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVVTCGQISLPGLYTNVG 362
            :..:.:|....: .::|.|||||||.|...|  ::...:.:||:.|.|...|.:.:   ::|||.
  Fly   199 INRNHICAESAN-ANTCNGDSGGPLTAIVTY--DHVQMVFQFGVTSFGHADCSKAT---VFTNVM 257

  Fly   363 EYVQWITDTM 372
            .::.||.:|:
  Fly   258 THLDWIVNTV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 78/255 (31%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 76/255 (30%)
Tryp_SPc 43..266 CDD:238113 78/257 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.