DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and CG17572

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:376 Identity:107/376 - (28%)
Similarity:157/376 - (41%) Gaps:76/376 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SARADYADDCTTPDGDQG-----QCMPFSSCRTIEERLTEAQKAGQKVPADYASYLQKALC-GEF 81
            :||:.|  |.....|..|     :|.|...|..:...:..:...|.|          ...| |..
  Fly    53 AARSYY--DVVQNAGQTGCSVGTECTPLHDCTALIYEVARSCYYGDK----------SLYCGGSS 105

  Fly    82 NGVRHFCCPSANIQHNSKVMSLFKDENFDCGNFLSQRVSNGYEVK-LSSRPWMALLRYQQFGESR 145
            ..:.:.||||:.::.|..           ||..|.|    |:..| |.|.|::|.:.::......
  Fly   106 EELPYVCCPSSPLEKNQV-----------CGKSLVQ----GHFYKGLGSYPFVARIGFKHVNTGA 155

  Fly   146 FL--CGGAMISERYILTAAHCV------HGLQNDLYEIRLGEHRISTEEDCRQQGRKKKCAPPVV 202
            |.  |.||:|:.|.|||||||.      |.|.:    :|:||:..|::.||...|   .|||..|
  Fly   156 FAYPCAGAVIARRVILTAAHCALAKADGHRLSS----VRVGEYDTSSDPDCANTG---FCAPRSV 213

  Fly   203 NVGIEKHLIHEKYDARHIMHDIALLKLNRSVPFQKHIKPICLPITDELKEKAEQI--STYFVTGW 265
            |..|...::|..|......||||||.|...:.:....:||||.     |.:|..:  ....:.||
  Fly   214 NHAISHVIVHPDYKQGQYHHDIALLVLKTPLNYSVATQPICLQ-----KTRANLVVGKRATIAGW 273

  Fly   266 GTTENGSSSDV----LLQANVPLQPRSACSQAYRRAVPL-------SQLCVGGGDLQDSCKGDSG 319
            |..   |:|.|    :...:|||.....|.:.|.....|       .|....||:.:|.|:|..|
  Fly   274 GKM---STSSVRQPEMSHLDVPLTSWDLCLRNYGSTGALESPNSIEGQWMCAGGEGKDVCQGFGG 335

  Fly   320 GPLQAPAQYLGEYAPKMVEFGIVSQGVVTCGQISLPGLYTNVGEYVQWITD 370
            .||.  .|..|.::    :.||:|.|...||.:.:|.:||:|..:.:||.|
  Fly   336 APLF--IQENGIFS----QIGIMSFGSDNCGGLRIPSVYTSVAHFSEWIHD 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829 10/63 (16%)
Tryp_SPc 121..371 CDD:238113 85/272 (31%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 82/264 (31%)
Tryp_SPc 138..378 CDD:214473 79/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.