DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and CG4650

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:275 Identity:67/275 - (24%)
Similarity:108/275 - (39%) Gaps:61/275 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 CGNFLSQRVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVHGLQ------ 169
            ||...:.:::|..     |.||||   |....|..::|||.:|:|:.:||||||....:      
  Fly    28 CGLLTNGKIANNI-----SSPWMA---YLHTSELLYVCGGTVITEKLVLTAAHCTRASEQLVARI 84

  Fly   170 ------NDLYEIRLGEHRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLK 228
                  :|..:..|.|:::|                        :..||..|:.....:|||:|.
  Fly    85 GEFIGTDDANDTMLSEYQVS------------------------QTFIHSLYNTTTSANDIAILG 125

  Fly   229 LNRSVPFQKHIKPICLPITDELKEKAEQISTYFVTGWGTTENGSSSDVLLQANVPLQPRSACSQA 293
            |...:.|.|.|:|||:......::..:.|.......||...:.:.||.....::..||.:.||..
  Fly   126 LATDIVFSKTIRPICIVWWTIWRKYIDNIQVLSGAQWGLPNDRNESDAFRITDIRRQPANMCSTL 190

  Fly   294 YRRAVPLSQLCVGGGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQ----GVVTCGQ-IS 353
            ...|:..||.|.|..| ...|..|...||.|           ::.|..:.:    |:.|..| ..
  Fly   191 NGTAILSSQFCAGDSD-SKLCNVDFSSPLGA-----------IITFKNIQRYVLIGIATTNQKCK 243

  Fly   354 LPGLYTNVGEYVQWI 368
            ...:||:|..:..:|
  Fly   244 RASVYTDVLSHTDFI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 65/265 (25%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 64/268 (24%)
Tryp_SPc 33..258 CDD:304450 64/268 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.