DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and CG33127

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster


Alignment Length:281 Identity:69/281 - (24%)
Similarity:109/281 - (38%) Gaps:67/281 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 VSNGYEVK-LSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVHGLQNDLYEIRLGEHRI 182
            :.:||:|: :.:.|::..|...: .....|||.::|.:|::|||||||..|:.      .....:
  Fly    41 IIDGYDVQGVDNVPYLVSLSLTR-ATYTHLCGASIIGKRWLLTAAHCVDELRT------FNGDAV 98

  Fly   183 STEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLKLNRSVPFQKHIKPICLP-I 246
            .|........|....|..|..|....  .|..::......:||||.::.|..:...::.|.|| |
  Fly    99 GTPVYAGIINRSNVTAAQVRYVDFAS--THRSFNGNAGSDNIALLHVSESFEYNARVQQIALPDI 161

  Fly   247 TDELKEKAEQISTYFVTGWGTTE------------------NGSSSDVLLQANVPLQPRSACSQA 293
            .|:...|     |....|||.|:                  |.:....||.|:.||..:..|||.
  Fly   162 NDDYSNK-----TAAAYGWGLTDPDGDEYSKELQYAFAPLLNSTGCKELLPADAPLTAQQVCSQV 221

  Fly   294 YRRAVPLSQLCVGGGDLQDSCKGDSGGPL-----QAPAQYLGEYAPKMVEFGIVSQGVVTCGQIS 353
                              .:|.||.|.||     ..||:.:          |:.|...:.||..:
  Fly   222 ------------------KTCYGDGGTPLIYWPITGPAELV----------GLGSWSYMPCGYAN 258

  Fly   354 LPGLYTNVGEYVQWITDTMAS 374
            .|.:||:|..|:.||..|:.:
  Fly   259 RPTVYTSVPPYIGWIHQTIGA 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 68/274 (25%)
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 68/276 (25%)
Tryp_SPc 41..273 CDD:214473 66/273 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449699
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.