DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and Tpsb2

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus


Alignment Length:273 Identity:85/273 - (31%)
Similarity:123/273 - (45%) Gaps:49/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 LSQRVS--NGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCV--HGLQNDLYEI 175
            :.|||.  .|.|...|..||...||: :|......|||::|..:::|||||||  |....:|:.:
  Rat    24 VKQRVGIVGGREASESKWPWQVSLRF-KFSFWMHFCGGSLIHPQWVLTAAHCVGLHIKSPELFRV 87

  Fly   176 RLGEHRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLKLNRSVPFQKHIK 240
            :|.|..:...:..               :.:.:.::|..|.......|||||:|...|....||.
  Rat    88 QLREQYLYYADQL---------------LTVNRTVVHPHYYTVEDGADIALLELENPVNVSTHIH 137

  Fly   241 PICLPITDELKEKAEQISTYFVTGWGTTENGSSSDVLL------QANVPLQPRSACSQAYRRA-- 297
            |..||...|.....   ::.:|||||..:   |.:.||      |..||:...|.|.:.|...  
  Rat   138 PTSLPPASETFPSG---TSCWVTGWGDID---SDEPLLPPYPLKQVKVPIVENSLCDRKYHTGLY 196

  Fly   298 ----VPLSQ---LCVGGGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVVTCGQISLP 355
                ||:.|   || .|....|||:|||||||....:  |.:    ::.|:||.| ..|.:.:.|
  Rat   197 TGDDVPIVQDGMLC-AGNTRSDSCQGDSGGPLVCKVK--GTW----LQAGVVSWG-EGCAEANRP 253

  Fly   356 GLYTNVGEYVQWI 368
            |:||.|..|:.||
  Rat   254 GIYTRVTYYLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 82/265 (31%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 82/267 (31%)
Tryp_SPc 30..266 CDD:214473 80/265 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.