DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and Prss27

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_891994.3 Gene:Prss27 / 287108 RGDID:1303256 Length:328 Species:Rattus norvegicus


Alignment Length:276 Identity:77/276 - (27%)
Similarity:124/276 - (44%) Gaps:47/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 CGN-FLSQRVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVHGLQN-DLY 173
            ||: .:..|:..|.:......||...:  |:.|  ...|||::|:..::||||||.....: .:|
  Rat    29 CGHPRMFNRMVGGEDALEGEWPWQVSI--QRNG--AHFCGGSLIAPTWVLTAAHCFSNTSDISIY 89

  Fly   174 EIRLGEHRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLKLNRSVPFQKH 238
            ::.||..::      :|.|      |..:.|.:::...|.:|.......|:||::|...|.|.|:
  Rat    90 QVLLGALKL------QQPG------PHALYVPVKRVKSHPEYQGMASSADVALVELQVPVTFTKY 142

  Fly   239 IKPICLPITDELKEKAEQISTYFVTGWGTTENGSSSD------VLLQANVPLQPRSACSQAYR-- 295
            |.|:|||....:.:..   ...:|||||:.   |..|      :|.:..|||.....|:..|.  
  Rat   143 ILPVCLPDPSVVFKSG---MNCWVTGWGSP---SEQDRLPNPRILQKLAVPLIDTPKCNLLYSKD 201

  Fly   296 -------RAVPLSQLCVGGGD-LQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVVTCGQI 352
                   :.:....||.|..: .:|:|||||||||.....      ...|:.|::|.| ..|.:.
  Rat   202 AEADIQLKTIKDDMLCAGFAEGKKDACKGDSGGPLVCLVD------QSWVQAGVISWG-EGCARR 259

  Fly   353 SLPGLYTNVGEYVQWI 368
            :.||:|..|..:.|||
  Rat   260 NRPGVYIRVASHYQWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 74/265 (28%)
Prss27NP_891994.3 Tryp_SPc 37..275 CDD:214473 73/266 (27%)
Tryp_SPc 39..278 CDD:238113 74/266 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.