DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and Prss30

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:273 Identity:84/273 - (30%)
Similarity:124/273 - (45%) Gaps:44/273 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 RVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHC-VHGLQNDLYEIRLGEHR 181
            ::..|.:......||...||.::.|.   :|||::|.|.::|||||| ...|.:..|.:::|...
  Rat    30 KIVGGQDAPEGRWPWQVSLRTEKEGH---ICGGSLIHEVWVLTAAHCFCRPLNSSFYHVKVGGLT 91

  Fly   182 ISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKY---DARHIMHDIALLKLNRSVPFQ-KHIKPI 242
            :|..|            |....|.:....::..|   ||.  ..|||||:|:  .|.| ....|:
  Rat    92 LSLTE------------PHSTLVAVRNIFVYPTYLWEDAS--SGDIALLRLD--TPLQPSQFSPV 140

  Fly   243 CLPITDELKEKAEQISTYFVTGWGTTENGSSSDVLLQANVPLQPRSACSQAY---------RRAV 298
            |||   :.:......:..:|||||.|.....:.||.:..|||.....|.:.|         :|.:
  Rat   141 CLP---QAQAPLTPGTVCWVTGWGATHERELASVLQELAVPLLDSEDCERMYHIGETSLSGKRVI 202

  Fly   299 PLSQLCVGGGDLQ-DSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVVTCGQISLPGLYTNVG 362
            ....||.|..:.| |||:|||||||.....      ...::.||.|.| :.|.:.:.||:||.|.
  Rat   203 QSDMLCAGFVEGQKDSCQGDSGGPLVCAIN------SSWIQVGITSWG-IGCARPNKPGVYTRVP 260

  Fly   363 EYVQWITDTMASN 375
            :||.||..|:|.|
  Rat   261 DYVDWIQRTLAEN 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 81/264 (31%)
Prss30NP_955403.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.