DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and CG33225

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster


Alignment Length:276 Identity:88/276 - (31%)
Similarity:136/276 - (49%) Gaps:39/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 DCGNFLS----QRVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVHGLQN 170
            |||....    :||..|.:....:.|||.::    .||:...|.|::|:..::||:|.|:..|..
  Fly    44 DCGTTRHPSRIRRVVGGNDADRFANPWMVMV----LGENNVFCSGSLITRLFVLTSASCLLSLPK 104

  Fly   171 DLYEIRLGEH-RISTEEDC---RQQGRKKKCAPPVVNVGIEKHLIHEKYDARHI-MHDIALLKLN 230
               ::.|||: |..|..||   ||.            :.|::.:||.::....: .:|||||:|.
  Fly   105 ---QVILGEYDRNCTSADCTSIRQV------------IDIDQKIIHGQFGLETVKKYDIALLRLA 154

  Fly   231 RSVPFQKHIKPICLPITDELKEKAEQISTYFVTGWGTTENGSSSDVLLQANVPLQPRSACSQAYR 295
            :.|....:::||||.:.   ::....:..:..|||||||....|.:|....:....|..|....|
  Fly   155 KKVSISDYVRPICLSVD---RQVGRSVQHFTATGWGTTEWNEPSTILQTVTLSKINRKYCKGRLR 216

  Fly   296 RAVPLSQLCVGGGDLQDSCKGDSGGPLQAPAQYLGE--YAPKMVEF--GIVSQGVVTCGQISLPG 356
            :.:..||||| ||..:|:|.||:||||....:..|:  :..|...|  ||||.|..:|..|   |
  Fly   217 QNIDASQLCV-GGPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSSSCSGI---G 277

  Fly   357 LYTNVGEYVQWITDTM 372
            :||||..|:.||..|:
  Fly   278 VYTNVEHYMDWIVRTI 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 82/258 (32%)
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 82/258 (32%)
Tryp_SPc 57..292 CDD:238113 83/260 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.