DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and CG33226

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:258 Identity:77/258 - (29%)
Similarity:128/258 - (49%) Gaps:22/258 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 QRVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVHGLQNDLYEIRLGEHR 181
            :::..|:...:...|||..:..:.:    ..|||::||..::|||||| |....  .::|.|.:.
  Fly    45 EQILGGHNADIKLHPWMVQILQRGY----HFCGGSLISSLFVLTAAHC-HSRYR--LKVRFGRYS 102

  Fly   182 -ISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLKLNRSVPFQKHIKPICLP 245
             |:....|..|    .|:|....:.:::..:|..|...| .:||||..|.:.|.:....:|||:.
  Fly   103 GITPRYLCSSQ----YCSPFGPEIDVKRIFLHSSYRDYH-NYDIALFLLAKPVRYNVQTRPICVL 162

  Fly   246 IT---DELKEKAEQISTYFVTGWGTTENGSSSDVLLQANVPLQPRSACSQAYRRAVPLSQLCVGG 307
            .|   |:|::....::.:.|||||.||:..:|.:|...::....|..|:|.:.|.:....:|.|.
  Fly   163 QTSNKDKLRQFLNYVAMFNVTGWGKTESQLTSTILQTTSLFHLDRKFCAQIFDRKIGWPHICAGH 227

  Fly   308 GDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVVTCGQISLPGLYTNVGEYVQWITD 370
            .. ..:|.|||||||.|...:.|  ..:.|.|||:|.|...|.:::   ::|||..|..||.|
  Fly   228 SQ-SSTCTGDSGGPLSAELTFSG--VKRTVLFGIISYGAPNCREVT---VFTNVLRYSNWIRD 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 77/254 (30%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 77/256 (30%)
Tryp_SPc 47..282 CDD:214473 74/252 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.