DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and CG33459

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster


Alignment Length:276 Identity:88/276 - (31%)
Similarity:129/276 - (46%) Gaps:42/276 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 DCGNF-LSQRVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVHGLQNDLY 173
            :||.. ...|:..|.:..|.|.||||.|.    ...:|||||::|:..::|||||||.....:| 
  Fly    28 NCGQIPFRMRIFGGMDAGLVSTPWMAFLH----NHLQFLCGGSLITSEFVLTAAHCVMPTPKNL- 87

  Fly   174 EIRLGEHRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHI----------MHDIALLK 228
            .:||||:..:.:.|.             :|   .||. |.:|....|          .:||||||
  Fly    88 TVRLGEYDWTRQMDS-------------IN---PKHR-HREYMVTRIYTHPSYRSIAAYDIALLK 135

  Fly   229 LNRSVPFQKHIKPICLPITDELKE---KAEQISTYFVTGWGTTENGSSSDVLLQANVPLQPRSAC 290
            ||::|.:...|:||||.:.:...|   ..:.:..:.:||||.|:....|.||..||:....|..|
  Fly   136 LNQTVEYTVAIRPICLVLPENFHEWYWLVDSVEDFTLTGWGATKTEPVSQVLQSANLTQIDRGTC 200

  Fly   291 SQAYRRAVPLSQLCVGGGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVVTCGQISLP 355
            ...|..:|..:.:|.|... ..:|.||||.||.....:...|....|  ||||:|...|..::  
  Fly   201 HDRYGHSVDHTHICAGSSK-SFACVGDSGSPLAMKVVHNRRYIHAQV--GIVSRGPKNCDGVT-- 260

  Fly   356 GLYTNVGEYVQWITDT 371
             ::|||..:.:||..|
  Fly   261 -VFTNVVSFTEWIFRT 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 84/262 (32%)
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 83/262 (32%)
Tryp_SPc 38..272 CDD:238113 82/261 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.