DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and CG33458

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster


Alignment Length:280 Identity:93/280 - (33%)
Similarity:137/280 - (48%) Gaps:41/280 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 FDCG-NFLSQRVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVHGLQNDL 172
            :||| :..:.|::.|.:..|...||:|.|..    .|:|:|||::::..::||||||... :|..
  Fly    27 WDCGISKYTYRITGGRDSPLMLNPWLAYLHI----NSKFICGGSLLNHWFVLTAAHCFRD-KNAK 86

  Fly   173 YEIRLGEHRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLKLNRSVPFQK 237
            ..:||||:..|.:.||.:    .:||.|.:...|.:.|||..|...| .:||||.||||.|.:..
  Fly    87 VLVRLGENDASQKIDCNE----SECAAPHLEYMIMQKLIHPLYRTAH-YYDIALAKLNRYVVYTD 146

  Fly   238 HIKPICLPITDELKEKAEQISTYFVTGWGTTENGSSSDVLLQANVPLQPRSACSQAYRRAVPLSQ 302
            .|:||||.:....:...:.|..:.:||||.|.....||.|....:|...|..|...:...|..:.
  Fly   147 SIRPICLMLNPNWQVYVDTIRYFIITGWGATNASEVSDKLQLTRIPQIDRFTCRYWFGYMVDRTH 211

  Fly   303 LCVG------GGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVS------QGVVTCGQISLP 355
            :|.|      |       ||||||||.:...|  :||.:..:|||||      .||         
  Fly   212 ICAGESKHYVG-------KGDSGGPLGSMVDY--KYAKRFFQFGIVSHLRQPFHGV--------- 258

  Fly   356 GLYTNVGEYVQWITDTMASN 375
            .::||:..|..||..|:.:|
  Fly   259 SVFTNILSYSNWIHRTIITN 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 87/261 (33%)
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 86/261 (33%)
Tryp_SPc 38..274 CDD:238113 87/263 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.