DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and Tpsg1

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:276 Identity:82/276 - (29%)
Similarity:116/276 - (42%) Gaps:72/276 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 RVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVHGLQNDL-YEIRLGEHR 181
            |:..|:.....:.||.|.||..:.    .:|||:::|..::||||||..|..|.. |::.|||  
Mouse    86 RIVGGHAAPAGTWPWQASLRLHKV----HVCGGSLLSPEWVLTAAHCFSGSVNSSDYQVHLGE-- 144

  Fly   182 ISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMH-----------DIALLKLNRSVPF 235
                                :.|.:..|....|   |.||:           ||||::|:..|..
Mouse   145 --------------------LTVTLSPHFSTVK---RIIMYTGSPGPPGSSGDIALVQLSSPVAL 186

  Fly   236 QKHIKPICLPITDELKEKAEQISTYF------VTGWGTTENGSSSDV---LLQANVPLQPRSACS 291
            ...::|:|||         |..:.::      |||||.|..|.....   |.:|.|.:.....||
Mouse   187 SSQVQPVCLP---------EASADFYPGMQCWVTGWGYTGEGEPLKPPYNLQEAKVSVVDVKTCS 242

  Fly   292 QAYR----RAVPLSQLCVGGGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVVTCGQI 352
            |||.    ..:....||..|..  |:|:.||||||  ..|..|.:.    :.|:||.| ..||:.
Mouse   243 QAYNSPNGSLIQPDMLCARGPG--DACQDDSGGPL--VCQVAGTWQ----QAGVVSWG-EGCGRP 298

  Fly   353 SLPGLYTNVGEYVQWI 368
            ..||:|..|..||.||
Mouse   299 DRPGVYARVTAYVNWI 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 81/273 (30%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 81/275 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.