DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and TPSG1

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:306 Identity:86/306 - (28%)
Similarity:128/306 - (41%) Gaps:90/306 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 NFDCGNFLSQ------RVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVH 166
            :||.|....|      |:..|:.....:.||.|.||.::.    .:|||:::|.:::||||||..
Human    46 SFDLGCGRPQVSDAGGRIVGGHAAPAGAWPWQASLRLRRV----HVCGGSLLSPQWVLTAAHCFS 106

  Fly   167 G-LQNDLYEIRLGEHRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMH-------- 222
            | |.:..|::.|||..|:...                         |.....:.|:|        
Human   107 GSLNSSDYQVHLGELEITLSP-------------------------HFSTVRQIILHSSPSGQPG 146

  Fly   223 ---DIALLKLNRSVPFQKHIKPICLPITDELKEKAEQIS---TYFVTGWGTTENGSSSDVLLQAN 281
               ||||::|:..|.....|.|:|||      |.::...   ..:|||||.|..|.         
Human   147 TSGDIALVELSVPVTLSSRILPVCLP------EASDDFCPGIRCWVTGWGYTREGE--------- 196

  Fly   282 VPLQPRSACSQAYRRAVPLSQLC------VGGGDLQ----------DSCKGDSGGPLQAPAQYLG 330
             ||.|..:..:. :.:|..::.|      .||..||          |:|:.||||||  ..|..|
Human   197 -PLPPPYSLREV-KVSVVDTETCRRDYPGPGGSILQPDMLCARGPGDACQDDSGGPL--VCQVNG 257

  Fly   331 EYAPKMVEFGIVSQGVVTCGQISLPGLYTNVGEYVQWITDTMASNG 376
            .:    |:.|.||.| ..||:.:.||:||.|..||.||...:.::|
Human   258 AW----VQAGTVSWG-EGCGRPNRPGVYTRVPAYVNWIRRHITASG 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 80/280 (29%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 79/280 (28%)
Tryp_SPc 63..293 CDD:238113 80/282 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.