DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and CG30288

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:278 Identity:93/278 - (33%)
Similarity:145/278 - (52%) Gaps:37/278 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 ENFDCG----NFLSQRVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVHG 167
            || |||    |....|:..|.:..:.|.|||  :|....|::  :|||::|:.|::|||.||:  
  Fly    28 EN-DCGTTSSNGYRARIDGGRDAGMESNPWM--VRVMISGKA--VCGGSLITARFVLTAEHCI-- 85

  Fly   168 LQNDLY-EIRLGE----HRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALL 227
              :.:| .:||||    |.|...:|.       .|.|...||.:::.::|....     :||.||
  Fly    86 --SPMYMNVRLGEYDTRHPIFDCDDF-------VCTPRAYNVDVDRKIVHSNPG-----YDIGLL 136

  Fly   228 KLNRSVPFQKHIKPICLPITDELKEKAEQISTYFVTGWGTTENGSSSDVLLQANVPLQPRSACSQ 292
            ::.|||.|..:::||||.:...|......|..:..|||||..:|...|.|..|.:...|:.:|.:
  Fly   137 RMQRSVIFSNYVRPICLILGKTLGGNPLSILRFNFTGWGTNSDGEEQDRLQTATLQQLPQWSCER 201

  Fly   293 AYRRAVPLSQLCVGGGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVVTCGQISLPGL 357
            . .|.:.:|.:| .|..:.|||||||||||.|...:.|:  .::.:||:.|||:..|..:   |:
  Fly   202 P-GRPLDISYIC-AGSYISDSCKGDSGGPLSAIRTFEGQ--GRVFQFGVASQGLRLCSGL---GI 259

  Fly   358 YTNVGEYVQWITDTMASN 375
            ||||..:..||.|.:.::
  Fly   260 YTNVTHFTDWILDVIQNH 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 85/254 (33%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 84/254 (33%)
Tryp_SPc 45..270 CDD:238113 83/251 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.