DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and CG30286

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:269 Identity:92/269 - (34%)
Similarity:139/269 - (51%) Gaps:23/269 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 DCGNFLSQRVSN-GYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVHGLQNDLY 173
            |||....:.:.| .::..:|..||||.|  .:.||  .:|||.:::.|:|||||||:.  :::..
  Fly    25 DCGYMSPEALQNEEHQAHISESPWMAYL--HKSGE--LVCGGTLVNHRFILTAAHCIR--EDENL 83

  Fly   174 EIRLGEHRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLKLNRSVPFQKH 238
            .:||||....|..||    ....|.||..:..|:....|..|...:.:|||.||:|.:||.::.|
  Fly    84 TVRLGEFNSLTSIDC----NGSDCLPPSEDFEIDVAFRHGGYSRTNRIHDIGLLRLAKSVEYKVH 144

  Fly   239 IKPICLPITDELKEKAEQISTYFVTGWGTTENGSSSDVLLQANVPLQPRSACSQAY---RRAVPL 300
            ||||||.....|:.|.|::.....||||.:.:.:::.:|....|.......||:.|   ||.   
  Fly   145 IKPICLITNTTLQPKIERLHRLVATGWGRSPSEAANHILKSIRVTRVNWGVCSKTYWVDRRR--- 206

  Fly   301 SQLCVGGGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVVTCGQISLPGLYTNVGEYV 365
            .|:|| ..:...||.||||||:....:..|...  .|:.||||.|...|  :| |.::|||.|::
  Fly   207 DQICV-SHESGVSCSGDSGGPMGQAIRLDGRVL--FVQVGIVSYGNAEC--LS-PSVFTNVMEHI 265

  Fly   366 QWITDTMAS 374
            .||...:::
  Fly   266 DWIMAALST 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 89/253 (35%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 87/248 (35%)
Tryp_SPc 39..268 CDD:214473 86/247 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.