DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and CG30088

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:293 Identity:105/293 - (35%)
Similarity:144/293 - (49%) Gaps:41/293 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 HFCCPSANIQHNSKVMSLFKDENFDCGNFLSQRVSNGYEVKLSSRPWMALLRYQQFGESRFLCGG 150
            :|..||..:.:.|.|               :.|:..|.|..|.|.|:||.|.|    .|...|||
  Fly    27 NFLIPSCGVSYESNV---------------ATRIVRGKEAMLKSAPFMAYLYY----SSEIHCGG 72

  Fly   151 AMISERYILTAAHCVHGLQNDLYEIRLGEHRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKY 215
            .:||.|||||||||:    ....::|||||.|:...||  ||  ..|:||.....|.....::::
  Fly    73 TIISSRYILTAAHCM----RPYLKVRLGEHDITRNPDC--QG--GSCSPPAEEFDIVLATKYKRF 129

  Fly   216 DARHIMHDIALLKLNRSVPFQKHIKPICLPITDELKEKAEQISTYFVTGWGTTENGSSSDVLLQA 280
            | |.:.:|||||||:|::.|..||:||||.:.........:...:   |||.||...|::||...
  Fly   130 D-RFLANDIALLKLSRNIRFNVHIQPICLILNPAAAPNVHEFQAF---GWGQTETNHSANVLQTT 190

  Fly   281 NVPLQPRSACSQAYRRAVPLSQLCVG--GGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVS 343
            .:.......|.......:.::|||||  |   .|:|.|||||||.....|.|.:  :.::.||||
  Fly   191 VLTRYDNRHCRSVLSMPITINQLCVGFQG---SDTCSGDSGGPLVTKVNYDGVW--RYLQLGIVS 250

  Fly   344 QGVVTCGQISLPGLYTNVGEYVQWITDTMASNG 376
            .|...|   ..||:||.|..|::||...|.|||
  Fly   251 FGDDKC---QSPGVYTYVPNYIRWIRYVMQSNG 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829 1/3 (33%)
Tryp_SPc 121..371 CDD:238113 95/251 (38%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 94/251 (37%)
Tryp_SPc 45..273 CDD:238113 94/251 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.