DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and Acr

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_036622.2 Gene:Acr / 24163 RGDID:2024 Length:437 Species:Rattus norvegicus


Alignment Length:284 Identity:93/284 - (32%)
Similarity:132/284 - (46%) Gaps:34/284 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 CGNFLSQ------RVSNGYEVKLSSRPWMALLRYQQFGESR--FLCGGAMISERYILTAAHCVHG 167
            ||....|      |:..|......:.|||..|:......||  ..|||::::..::||||||...
  Rat    29 CGLRFRQNPQAGIRIVGGQTSSPGAWPWMVSLQIFTSHNSRRYHACGGSLLNSHWVLTAAHCFDN 93

  Fly   168 LQNDLYEIRL--GEHRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLKLN 230
             :..:|:.||  |.|.|       :.||.|....|.....::|.:|||||:|....:||||||:.
  Rat    94 -KKKVYDWRLVFGAHEI-------EYGRNKPVKEPQQERYVQKIVIHEKYNAVTEGNDIALLKVT 150

  Fly   231 RSVPFQKHIKPICLPITDELKEKAEQI-STYFVTGWGTTENGS--SSDVLLQANVPLQPRSAC-- 290
            ..|.....:.|.|||   ..|....:| .|.:|||||..::.:  .|.||::|.|.|.....|  
  Rat   151 PPVTCGDFVGPGCLP---HFKSGPPRIPHTCYVTGWGYIKDNAPRPSPVLMEARVDLIDLDLCNS 212

  Fly   291 SQAYRRAVPLSQLCVG--GGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVVTCGQIS 353
            :|.|...|..:.:|.|  .|.: |:|:|||||||.........:    |..||.|.| |.|.:..
  Rat   213 TQWYNGRVTSTNVCAGYPEGKI-DTCQGDSGGPLMCRDSVDSPF----VIVGITSWG-VGCARAK 271

  Fly   354 LPGLYTNVGEYVQWITDTMASNGL 377
            .||:||...:|:.||...:....|
  Rat   272 RPGVYTATWDYLDWIASKIGPTAL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 88/260 (34%)
AcrNP_036622.2 Tryp_SPc 42..286 CDD:214473 87/260 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.