DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and Tpsb2

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:269 Identity:82/269 - (30%)
Similarity:122/269 - (45%) Gaps:43/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 SQRVS--NGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCV--HGLQNDLYEIR 176
            :|||.  .|:|...|..||...||::......| |||::|..:::|||||||  |.....|:.::
Mouse    27 NQRVGIVGGHEASESKWPWQVSLRFKLNYWIHF-CGGSLIHPQWVLTAAHCVGPHIKSPQLFRVQ 90

  Fly   177 LGEHRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLKLNRSVPFQKHIKP 241
            |.|..:...:..               :.:.:.::|..|.......|:|||:|...|....|:.|
Mouse    91 LREQYLYYGDQL---------------LSLNRIVVHPHYYTAEGGADVALLELEVPVNVSTHLHP 140

  Fly   242 ICLPITDELKEKAEQISTYFVTGWGTTENGSSSD---VLLQANVPLQPRSACSQAYRRAV----- 298
            |.||...|.....   ::.:|||||..:|.....   .|.|..||:...|.|.:.|...:     
Mouse   141 ISLPPASETFPPG---TSCWVTGWGDIDNDEPLPPPYPLKQVKVPIVENSLCDRKYHTGLYTGDD 202

  Fly   299 -PL---SQLCVGGGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVVTCGQISLPGLYT 359
             |:   ..|| .|...:|||:|||||||....:  |.:    ::.|:||.| ..|.|.:.||:||
Mouse   203 FPIVHDGMLC-AGNTRRDSCQGDSGGPLVCKVK--GTW----LQAGVVSWG-EGCAQPNKPGIYT 259

  Fly   360 NVGEYVQWI 368
            .|..|:.||
Mouse   260 RVTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 79/262 (30%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 79/264 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.