DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and CG43125

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:302 Identity:76/302 - (25%)
Similarity:124/302 - (41%) Gaps:96/302 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 SLFKDENFDCGNFLSQRVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVH 166
            :||.::|  ||.          ....|..||:..:|.:.  .|...|.|.:|:||::||||.|: 
  Fly    20 ALFLEQN--CGK----------SSVFSPAPWLVKIRPEL--SSNITCTGTLINERFVLTAASCI- 69

  Fly   167 GLQNDLYEIRLGEHRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLKLNR 231
            ..|.:|. :||||...:.:...:.|..:         :.:.:.|||..|.:....::||||:|..
  Fly    70 DYQTELI-VRLGEIDGTLQNSSKLQYEE---------IYVARALIHRSYSSESHQYNIALLRLKT 124

  Fly   232 SVPFQKHIKPICLPI---------TDELKEK------------AEQISTYFVTGWGTTENGSSSD 275
            ||.::|:|:|||:.:         |.|:::|            .::...:|::.:|..|  ...|
  Fly   125 SVVYKKNIQPICIDVNVGKVPKAPTFEIEKKKNEEPKKNKAGIMKRFLNWFLSLFGVRE--PRPD 187

  Fly   276 VLLQANVPLQPRSACSQAYRRAVPLSQLCVGGGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFG 340
            |:|    |.||.:.                             |.||   .:.:.|.| ...::|
  Fly   188 VIL----PPQPIAV-----------------------------GWPL---TKQINESA-LFHQYG 215

  Fly   341 IVSQGVVTCGQISLPGLYTNVGEYVQWITD-------TMASN 375
            |:|..    ...|...:||:|..||.|||.       |||.|
  Fly   216 ILSHR----NSESKKDVYTDVMAYVNWITPLALDVHITMAPN 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 67/277 (24%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 36/112 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.