DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and LOC101734670

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_004920158.2 Gene:LOC101734670 / 101734670 -ID:- Length:275 Species:Xenopus tropicalis


Alignment Length:271 Identity:81/271 - (29%)
Similarity:128/271 - (47%) Gaps:33/271 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 SQRVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVHGLQNDLYEIRLGEH 180
            |.||.||...|..|.||...|::.:.|.....|||.:|::|:|||||||::....:  .:.:|::
 Frog    25 SARVVNGENAKPYSWPWQVSLQFLEDGVFLHNCGGTLIADRWILTAAHCINFSWTN--RVVVGDY 87

  Fly   181 RISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHE--KYDARHIMHDIALLKLNRSVPFQKHIKPIC 243
            .::.||...|          :..:..|...:|:  ||:.....:||||::|:|.|.....::..|
 Frog    88 DLANEEGAEQ----------IFLIPSEDMFVHQSWKYNCIPCGNDIALIRLSRPVQISDKVQLSC 142

  Fly   244 LPITDELKEKAEQISTYFVTGWGTTENGSS-SDVLLQANVPLQPRSACSQA--YRRAVPLSQLCV 305
            ||...||  .....|.| .:|||....|.. .|:|.||.:|:...:.|:|.  :...|..|.:| 
 Frog   143 LPPAGEL--LPNNFSCY-ASGWGRLYTGGPIPDILQQALLPVVDHNHCTQRDWWGTKVKRSMVC- 203

  Fly   306 GGGDLQDSCKGDSGGPLQAPAQ----YLGEYAPKMVEFGIVSQGVVTCGQISLPGLYTNVGEYVQ 366
            .|||::..|.|||||||.....    |:...|..:..:|        |..:..|.::|.|..:..
 Frog   204 AGGDIRSVCNGDSGGPLNCQGADGRWYVHGVASFVHGYG--------CNTLKKPSVFTRVSAFNS 260

  Fly   367 WITDTMASNGL 377
            ||..|::.|.:
 Frog   261 WIQQTISENSV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 76/258 (29%)
LOC101734670XP_004920158.2 Tryp_SPc 28..265 CDD:238113 77/260 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.