DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and zgc:163079

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:306 Identity:85/306 - (27%)
Similarity:132/306 - (43%) Gaps:56/306 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 EFNGVRHFCCPSANIQHNSKVMSLFKDENFDCGNF-LSQRVSNGYEVKLSSRPWMALLRYQQFGE 143
            :||.|  ||...|.:.:.:..:.    ::..||.. |:.::..|......|.||.|.:..:...|
Zfish     2 KFNSV--FCVAGAILLNIAGCLG----QSDVCGRAPLNTKIIGGLNATQGSWPWQASINLKATEE 60

  Fly   144 SRFLCGGAMISERYILTAAHCVHGLQ--NDLYEIRLGEHRISTEEDCRQQGRKKKCAPPVVNVGI 206
              |.|||::|::.::||.|. |..|.  :|:. :.||..        .|.|..    |..::..:
Zfish    61 --FYCGGSLINKGWVLTTAK-VFALMPASDIV-VYLGRQ--------TQNGSN----PYEISRTV 109

  Fly   207 EKHLIHEKYDARHIMHDIALLKLNRSVPFQKHIKPICLPITDELKEKAEQISTYFVTGWG----- 266
            .|.:.|..|::  :..::|||||:..|.|..:|||:||.....:....   :..:|||||     
Zfish   110 TKIIKHPNYNS--LDSNLALLKLSSPVTFSDYIKPVCLAAAGSVFVDG---TASWVTGWGYLNRP 169

  Fly   267 -TTENGSSSDVLLQANVPLQPRSACSQAYRRAVPLSQLCVG--GGDLQDSCKGDSGGPLQAPAQY 328
             |.|.....|||.:...|:.....|:.||...:....||.|  ..|.:..|.||.||||      
Zfish   170 ATVEEIMLPDVLQEVEAPIVNNFECNAAYGGIITNKLLCAGYLNEDGKAPCAGDVGGPL------ 228

  Fly   329 LGEYAPKMVEFGI--VSQGVVTCGQISLPG---LYTNVGEYVQWIT 369
                   :::.|.  :..|||..|...|||   :|..|.||..||:
Zfish   229 -------VIKQGAIWIQSGVVVSGYCGLPGYPTIYVRVSEYEDWIS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829 5/9 (56%)
Tryp_SPc 121..371 CDD:238113 76/264 (29%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 74/264 (28%)
Tryp_SPc 36..267 CDD:238113 75/264 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.