DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grass and si:dkey-16l2.17

DIOPT Version :9

Sequence 1:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_001341498.1 Gene:si:dkey-16l2.17 / 100001520 ZFINID:ZDB-GENE-141212-262 Length:305 Species:Danio rerio


Alignment Length:278 Identity:79/278 - (28%)
Similarity:133/278 - (47%) Gaps:42/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 CGN-FLSQRVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCV-HGLQNDLY 173
            ||. .|.:|:..|.|....|.||...:   |.|.:..:|||::|::.::|:||||. :..:...|
Zfish    23 CGRPPLGKRIVGGVEASPGSWPWQVDI---QMGSNGHVCGGSIIAKNWVLSAAHCFPNPSEVSAY 84

  Fly   174 EIRLGEHRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLKLNRSVPFQKH 238
            .:.:|.|.::......:...            :::.:|.|.|.......|:||::|...|.:...
Zfish    85 TLYMGRHLLNGYNQFEKVSY------------VQRVVIPEGYTDPQGGRDVALVQLRAPVSWTDR 137

  Fly   239 IKPICLPITDELKEKAEQISTYFVTGWGTTENGSS---SDVLLQANVPLQPRSACSQAYR----- 295
            |:|:|||..|   .:....:..:|||||..:.|.|   :..|.:..||:..:|:|...|:     
Zfish   138 IQPVCLPFAD---FQFNSGTLCYVTGWGHKQEGVSLTGAAALREVEVPIIDQSSCQFMYQILSSD 199

  Fly   296 -RAVPL--SQLCVG---GGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVVTCGQISL 354
             ..|.:  ..:|.|   ||  :|||:|||||||..|   :|.  ...::.|:||.| :.|.|.:.
Zfish   200 SSTVDILSDMICAGYKEGG--KDSCQGDSGGPLVCP---VGN--GTWIQAGVVSFG-LGCAQKNR 256

  Fly   355 PGLYTNVGEYVQWITDTM 372
            ||:|:.|..:.:.|..|:
Zfish   257 PGIYSRVSSFEKLIRTTV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 74/264 (28%)
si:dkey-16l2.17XP_001341498.1 Tryp_SPc 32..273 CDD:238113 74/266 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.