DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6051 and VPS27

DIOPT Version :10

Sequence 1:NP_001097943.1 Gene:CG6051 / 43271 FlyBaseID:FBgn0039492 Length:989 Species:Drosophila melanogaster
Sequence 2:NP_014403.3 Gene:VPS27 / 855739 SGDID:S000005289 Length:622 Species:Saccharomyces cerevisiae


Alignment Length:82 Identity:37/82 - (45%)
Similarity:45/82 - (54%) Gaps:10/82 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   884 SNNETQMPSSATSTSATLSPPAWIPDGKAPRCMACQTPFTAFRRRHHCRNCGGVFCGVCSNASAP 948
            ||:.|.|..|.|       |..|| |..|  ||.|...|:...|:||||:||||||...|:.|.|
Yeast   155 SNSPTAMFDSKT-------PADWI-DSDA--CMICSKKFSLLNRKHHCRSCGGVFCQEHSSNSIP 209

  Fly   949 LPKYGLTKAVRVCRDCY 965
            ||..|:.:.||||..|:
Yeast   210 LPDLGIYEPVRVCDSCF 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6051NP_001097943.1 FYVE_LST2 902..966 CDD:277270 31/64 (48%)
VPS27NP_014403.3 VHS_Vps27 7..149 CDD:340776
FYVE_like_SF 169..226 CDD:333710 29/59 (49%)
GAT_Vps27 349..432 CDD:410590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.