DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6051 and AT1G29800

DIOPT Version :9

Sequence 1:NP_001097943.1 Gene:CG6051 / 43271 FlyBaseID:FBgn0039492 Length:989 Species:Drosophila melanogaster
Sequence 2:NP_174273.3 Gene:AT1G29800 / 839858 AraportID:AT1G29800 Length:510 Species:Arabidopsis thaliana


Alignment Length:133 Identity:42/133 - (31%)
Similarity:59/133 - (44%) Gaps:22/133 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   859 ASSTSSSSEQNSPVSARSGSRRRLQSNNETQMPSSATSTS-------ATLSPPAWIPDGKAPRCM 916
            ||:.||.:.:...::..||   .|.......|..:.|..:       ....||.|:||..|..||
plant   131 ASALSSGNLERCGINFLSG---HLLEQAWQDMAHTLTEANFGNAREILETEPPKWLPDSAASACM 192

  Fly   917 ACQTPFTAFR-RRHHCRNCGGVFCGVCSNASAPLP-KYGLTKAVRVCRDCYVREVRSGMGVQGVQ 979
            .|...|.... .|||||.|||:||..||...:.:| |:.::...|||..|:||          ::
plant   193 LCSVRFHPIMCSRHHCRYCGGIFCRDCSKGKSLVPVKFRVSDPQRVCDVCFVR----------LE 247

  Fly   980 SVQ 982
            |||
plant   248 SVQ 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6051NP_001097943.1 FYVE_LST2 902..966 CDD:277270 28/65 (43%)
AT1G29800NP_174273.3 FYVE 180..248 CDD:279674 29/77 (38%)
SYLF_FYVE 288..490 CDD:211402
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1089
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.