DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6051 and AT3G43230

DIOPT Version :9

Sequence 1:NP_001097943.1 Gene:CG6051 / 43271 FlyBaseID:FBgn0039492 Length:989 Species:Drosophila melanogaster
Sequence 2:NP_189909.1 Gene:AT3G43230 / 823398 AraportID:AT3G43230 Length:485 Species:Arabidopsis thaliana


Alignment Length:261 Identity:66/261 - (25%)
Similarity:90/261 - (34%) Gaps:69/261 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   742 SIYSAEEV----------NPELDNVFSAGGGNQATGQRHSAGASMQRNNT----IDLASQPGEGS 792
            |.||.|.:          :.:.|...|..||....|.:.|..:...:...    ||......:|.
plant     9 SPYSEENIKFKYDDYDDDDDDDDGSGSGSGGGYEDGPKWSVQSIPTKKEVEYPIIDSGDYVDDGY 73

  Fly   793 PSGATTATSRSHVTRSRSLGDQEAASSATSSTAQLRQLEQQQQQQQLQIQLQRQRN-NSVGSNTP 856
            .|....:|:    |.....|:::...:..:....|             |.:...|| |.:....|
plant    74 DSSGELSTT----TTPPIQGNEKPEVNLKNVLTGL-------------IAIVTGRNKNPLDQKNP 121

  Fly   857 SSASSTSSSSEQNSPVSARSGSRRRLQSNNETQMPSSATSTSA------------------TLSP 903
            ||..|...|.                 :|.:|.:.||....||                  ...|
plant   122 SSNVSFLGSG-----------------TNGDTFVHSSVYIPSAPPLLEPSGINYSVYKELLEAEP 169

  Fly   904 PAWIPDGKAPRCMACQTPFTAFR-RRHHCRNCGGVFCGVCSNASAPLP-KYGLTKAVRVCRDCYV 966
            |.|:||..|..||.|.|||||.. .|||||.|||:||..||.....:| ::......|||..||.
plant   170 PEWLPDSLASTCMQCSTPFTAITCGRHHCRFCGGIFCRNCSKGRCLMPSRFRERNPQRVCDSCYE 234

  Fly   967 R 967
            |
plant   235 R 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6051NP_001097943.1 FYVE_LST2 902..966 CDD:277270 31/65 (48%)
AT3G43230NP_189909.1 FYVE 171..236 CDD:366594 31/65 (48%)
SYLF_FYVE 278..479 CDD:211402
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1089
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.