DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6051 and RUFY1

DIOPT Version :9

Sequence 1:NP_001097943.1 Gene:CG6051 / 43271 FlyBaseID:FBgn0039492 Length:989 Species:Drosophila melanogaster
Sequence 2:NP_079434.3 Gene:RUFY1 / 80230 HGNCID:19760 Length:708 Species:Homo sapiens


Alignment Length:394 Identity:94/394 - (23%)
Similarity:148/394 - (37%) Gaps:93/394 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   617 CSLEAADPERIQPDREQNLASGDTSAASSLSDDVSLAMRNTTARLK-FKSTENLLHRLFVCIAGV 680
            |||:    |..|..||||....:.|..|     |.:..::|...|: :|.|...|..::      
Human   351 CSLQ----EEQQQLREQNELIRERSEKS-----VEITKQDTKVELETYKQTRQGLDEMY------ 400

  Fly   681 ADQLQTNFASDLRQILRSVFLMNMSTAQE-EIDIPEKTKESELFEFRASENDVIQES---AGSNQ 741
                     ||:.:.|:....:.:...:| |:.|..|| |.|: ..:..|.|..::.   ....|
Human   401 ---------SDVWKQLKEEKKVRLELEKELELQIGMKT-EMEI-AMKLLEKDTHEKQDTLVALRQ 454

  Fly   742 SIYSAEEVNPELDNVFSAGGGNQATGQRHSAGASMQRNNTIDLAS--------QPGEGSPSGATT 798
            .:...:.:|  |.....|.....:..|::.|..|.:......::|        |..|.:..|   
Human   455 QLEEVKAIN--LQMFHKAQNAESSLQQKNEAITSFEGKTNQVMSSMKQMEERLQHSERARQG--- 514

  Fly   799 ATSRSHVTRSRSLGDQEAASSATSSTAQLRQLEQQ------------QQQQQLQIQLQRQRNNS- 850
            |..|||..:      ||......:...||.||.:|            :|:|.||.:||.:::.| 
Human   515 AEERSHKLQ------QELGGRIGALQLQLSQLHEQCSSLEKELKSEKEQRQALQRELQHEKDTSS 573

  Fly   851 ---------------VGSNTPSSASSTSSSSEQNSPVSAR----SGSRRRLQSNNETQMPSSATS 896
                           :.......|.......||...:...    |.|:.:::...|         
Human   574 LLRMELQQVEGLKKELRELQDEKAELQKICEEQEQALQEMGLHLSQSKLKMEDIKE--------- 629

  Fly   897 TSATLSPPAWIPDGKAPRCMACQTPFTAFRRRHHCRNCGGVFCGVCSNASAPLPKYGLTKAVRVC 961
            .:..|...||:.|.:|..|..|:..|:..||:|||||||.:||..||:....||.|  .|.||||
Human   630 VNQALKGHAWLKDDEATHCRQCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSY--PKPVRVC 692

  Fly   962 RDCY 965
            ..|:
Human   693 DSCH 696

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6051NP_001097943.1 FYVE_LST2 902..966 CDD:277270 29/64 (45%)
RUFY1NP_079434.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..57
RUN 147..270 CDD:280855
DUF4201 451..612 CDD:290581 32/171 (19%)
AAA_23 <486..601 CDD:290211 24/123 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 493..522 8/31 (26%)
Interaction with RAB4. /evidence=ECO:0000250 615..625 2/9 (22%)
FYVE_RUFY1 634..704 CDD:277297 30/65 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149898
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.