DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6051 and Zfyve19

DIOPT Version :9

Sequence 1:NP_001097943.1 Gene:CG6051 / 43271 FlyBaseID:FBgn0039492 Length:989 Species:Drosophila melanogaster
Sequence 2:XP_006500266.1 Gene:Zfyve19 / 72008 MGIID:1919258 Length:396 Species:Mus musculus


Alignment Length:52 Identity:21/52 - (40%)
Similarity:32/52 - (61%) Gaps:1/52 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   914 RCMACQTPFTAFRRRHHCRNCGGVFCGVCSNASAPLPKYGLTKAVRVCRDCY 965
            ||..|...||.|::.:.|:|||..||..|.:.||.:|:.|.|:. :||:.|:
Mouse     4 RCYGCAVKFTLFKKEYGCKNCGRAFCNGCLSFSALVPRAGNTQQ-KVCKQCH 54

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6051NP_001097943.1 FYVE_LST2 902..966 CDD:277270 21/52 (40%)
Zfyve19XP_006500266.1 FYVE_ZFY19 4..54 CDD:277288 20/50 (40%)
PRK11281 122..>305 CDD:236892
Bbox1_ANCHR-like 343..387 CDD:380875
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839958
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.