powered by:
Protein Alignment CG6051 and Zfyve19
DIOPT Version :9
Sequence 1: | NP_001097943.1 |
Gene: | CG6051 / 43271 |
FlyBaseID: | FBgn0039492 |
Length: | 989 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006500266.1 |
Gene: | Zfyve19 / 72008 |
MGIID: | 1919258 |
Length: | 396 |
Species: | Mus musculus |
Alignment Length: | 52 |
Identity: | 21/52 - (40%) |
Similarity: | 32/52 - (61%) |
Gaps: | 1/52 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 914 RCMACQTPFTAFRRRHHCRNCGGVFCGVCSNASAPLPKYGLTKAVRVCRDCY 965
||..|...||.|::.:.|:|||..||..|.:.||.:|:.|.|:. :||:.|:
Mouse 4 RCYGCAVKFTLFKKEYGCKNCGRAFCNGCLSFSALVPRAGNTQQ-KVCKQCH 54
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167839958 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.