DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6051 and Rundc3b

DIOPT Version :9

Sequence 1:NP_001097943.1 Gene:CG6051 / 43271 FlyBaseID:FBgn0039492 Length:989 Species:Drosophila melanogaster
Sequence 2:XP_006236065.1 Gene:Rundc3b / 688590 RGDID:1587590 Length:452 Species:Rattus norvegicus


Alignment Length:420 Identity:84/420 - (20%)
Similarity:140/420 - (33%) Gaps:113/420 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 EEVLQENLAGQL-WFGAEC---------LAAGSSIMNRETESKEMRPLAQAVTKSLGNVRVLLRD 143
            |::|...|.||: |||.|.         :|......|.....:.|..::.:..|....:||.|.:
  Rat    67 EQILSHRLKGQVTWFGYESPRSFWDYIRVACRKVSQNCICSIENMENVSSSRAKGRAWIRVALME 131

  Fly   144 QCLKNNVPNSKTLHLDLND-STTEQLYE------------------SLKIFDRLFA--------- 180
            :.|      |:.:...|.| .||.:.||                  .|...|..|.         
  Rat   132 KHL------SEYISTALRDFKTTRRFYEEGAIVLGEEANMLAGMLLGLNAIDFSFCLKGEGLDGT 190

  Fly   181 -----------EFELSYVSAMVQVKSRHEYEMQQWIGVLFSETLQRALKIGLLDQE--MVDAFDP 232
                       :||.|..|.     |..|.|::.:               |..|.|  ..:...|
  Rat   191 FPAVIDYTPYLKFEQSSDSI-----SSDEEELRTF---------------GSSDSEGSTPENVGP 235

  Fly   233 GLMF-------SIPRLAIVAGLVVYAKGPLN--MDMPGDQLSEMFRPFRTILIKIR--DLLRNLN 286
            .|:.       ...|:.....|.:..||.|.  :.:..:||||.....:.:|.:|.  ||...|.
  Rat   236 PLILDENSWFNKCKRVRQKYQLTLEQKGYLEELLRLRENQLSESVSQNKILLQRIEDSDLAHKLE 300

  Fly   287 NQEL-YQLEKL-----LCTNEDINTKVPLGSS-SIEAPSP-----EHSSHPTTSSSQNNNNSSNN 339
            .::| |.:.:|     :..|.|:.::..|.:. :.:.|||     ...:..|....::|....:.
  Rat   301 KEQLEYIIVELQDQLTVLKNNDLRSRQELTAHLTNQWPSPGALDVNAVALDTLLYRKHNKQWYDK 365

  Fly   340 NHSSSSTNTTSTTTTTAGTTNTHRTVERLVDQRNNNHNSNSNSSTNPTVEAATLRSPSMLSLSAT 404
            ::.|....:...:.:.|.           :|..::........|.|...|... .:||:|.|..:
  Rat   366 SYQSLDQLSAEVSLSQAS-----------LDPGHSQEGDGKQDSLNFIGEGKE-DTPSLLGLCGS 418

  Fly   405 STPTASPAPSPTPSHSIASTSSAATSSTNP 434
            .|..|| ..|.|...|....:|..|..|:|
  Rat   419 LTSVAS-YKSLTSLKSNDCLASPTTEITSP 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6051NP_001097943.1 FYVE_LST2 902..966 CDD:277270
Rundc3bXP_006236065.1 RUN 61..184 CDD:280855 27/122 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343810
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.