DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6051 and plekhf1

DIOPT Version :9

Sequence 1:NP_001097943.1 Gene:CG6051 / 43271 FlyBaseID:FBgn0039492 Length:989 Species:Drosophila melanogaster
Sequence 2:NP_001016010.1 Gene:plekhf1 / 548764 XenbaseID:XB-GENE-996039 Length:269 Species:Xenopus tropicalis


Alignment Length:118 Identity:41/118 - (34%)
Similarity:57/118 - (48%) Gaps:8/118 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   865 SSEQNSPVSARSGSRRR-----LQSNNETQMPSSATSTSATLSPPAWIPDGKAPRCMAC-QTPFT 923
            :|:::..|||.|.|.|:     ::......:..:....|...:.| ||||.....||.| ||.||
 Frog   104 TSKKSFVVSAASYSERKEWICHIEECIHQLLQKTGRQPSKEHAAP-WIPDKATDICMRCTQTNFT 167

  Fly   924 AFRRRHHCRNCGGVFCGVCSNASAPLPKYGLTKAVRVCRDCYVREVRSGMGVQ 976
            ...||||||.||.|.|..||.....:|.. .:|.||||..||.:.|...:.::
 Frog   168 LVNRRHHCRKCGFVVCHECSKYKFLIPTI-KSKPVRVCSLCYKKLVSEKVAIE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6051NP_001097943.1 FYVE_LST2 902..966 CDD:277270 31/64 (48%)
plekhf1NP_001016010.1 PH_Phafin2-like 7..129 CDD:269927 7/24 (29%)
PH 39..131 CDD:278594 7/26 (27%)
PHD_SF 148..211 CDD:304600 32/64 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.