DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6051 and Rufy3

DIOPT Version :9

Sequence 1:NP_001097943.1 Gene:CG6051 / 43271 FlyBaseID:FBgn0039492 Length:989 Species:Drosophila melanogaster
Sequence 2:XP_006535172.1 Gene:Rufy3 / 52822 MGIID:106484 Length:687 Species:Mus musculus


Alignment Length:280 Identity:57/280 - (20%)
Similarity:102/280 - (36%) Gaps:51/280 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   702 MNMSTAQEEIDIPEK-----TKESELFEFRASENDVIQESAGSNQSIYSAEEVNPELDNVFSAGG 761
            |.::....|.|:.||     :...:|.:.||.::::..:...|:..:....|:|..|:       
Mouse   441 MELAMKMLEKDVCEKQDALVSLRQQLDDLRALKHELAFKLQSSDLGVKQKSELNSRLE------- 498

  Fly   762 GNQATGQRHSAGASMQRNNTIDLASQPGEGSPSGATTATSRSHVTRSRSLGDQEAASSATSSTAQ 826
              :.|.|  .|....|....:..|.:             .|........|..|:......|...:
Mouse   499 --EKTNQ--MAATIKQLEQRLRQAER-------------GRQSAELDNRLFKQDFGDKINSLQLE 546

  Fly   827 LRQLEQQQQQQQLQIQLQRQRNNSVGSNTPSSASSTSSSSEQNSPVSARSGSRRRLQSNNETQMP 891
            :..|.:|:.|.:|:::.:::| .|....||...:...         ..|...:.|:|..| .::.
Mouse   547 VEALTRQRTQLELELKQEKER-KSQNRGTPGKGAQKP---------ELRMDGKHRIQEEN-VKLK 600

  Fly   892 SSATSTSATLSPPAWIPDG------KAPRCMACQTPFTAFRRRHHCRNCGGVFCGVCSNASAPLP 950
            .....:...|:.|| ...|      |...|..||...:.  .::.||||.|.||..|:....|||
Mouse   601 KPLEESHRLLTHPA-EEQGQPSLSEKPQVCQLCQEDDSL--TKNTCRNCRGTFCNACTTNELPLP 662

  Fly   951 KYGLTKAVRVCRDCYVREVR 970
              ...|..|||..|:.:.::
Mouse   663 --SSIKPERVCNPCHEQLIK 680

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6051NP_001097943.1 FYVE_LST2 902..966 CDD:277270 23/69 (33%)
Rufy3XP_006535172.1 RUN 171..292 CDD:367169
Smc <340..>570 CDD:224117 26/153 (17%)
FYVE_RUFY3 629..675 CDD:277283 18/49 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839956
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.