DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6051 and Rundc3a

DIOPT Version :9

Sequence 1:NP_001097943.1 Gene:CG6051 / 43271 FlyBaseID:FBgn0039492 Length:989 Species:Drosophila melanogaster
Sequence 2:XP_006533751.1 Gene:Rundc3a / 51799 MGIID:1858752 Length:465 Species:Mus musculus


Alignment Length:395 Identity:79/395 - (20%)
Similarity:136/395 - (34%) Gaps:105/395 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 GQLWFGAECLAAGSSIMNRETESKE-MRPLAQAVTKSLGNVRVLLRDQCLKNNVPNSKTLHLDLN 161
            ||..|......|.|.:.|....|.| |..::.|..|....:||.|.::.:...:..:      |.
Mouse   100 GQRGFWDYIRLACSKVPNNCVSSIENMENISTARAKGRAWIRVALMEKRMSEYITTA------LR 158

  Fly   162 DS-TTEQLYESLKIFDRLFAEFELSYVSAMVQVKSRHEYEMQQWIGVLFSETLQRALKIGLLDQE 225
            |: ||.:.|:|..|..|    .|.:.::.|:...|..::..              .||..:||.:
Mouse   159 DNRTTRRFYDSGAIMLR----EEATVLTGMLIGLSAIDFSF--------------CLKGEVLDGK 205

  Fly   226 --MVDAFDPGLMFS--------------------------IPRLAIVAG---------------L 247
              :|..:.|.|.|:                          .|.|.:|..               .
Mouse   206 TPVVIDYTPYLKFTQSYDYLTDEEERHSAESSTSEDNSPEHPYLPLVTDEDSWYNKWHKMEQKFR 270

  Fly   248 VVYA-KGPLN--MDMPGDQLSEMFRPFRTILIKIRDLLRNLNNQELYQLEKLLCTNEDINTKVPL 309
            :||| ||.|.  :.:...||.::....|.:.:::.:.... |.:|..:||.::.   ::..::| 
Mouse   271 IVYAQKGYLEELVRLRESQLKDLEAENRRLQLQLEEAAAQ-NQREKRELEGVIL---ELQEQLP- 330

  Fly   310 GSSSIEAPSPEHSSHPTTSSSQNNNNSSNNNHSSSSTNTTSTTTTTAGTTNTHRTVERLVDQRNN 374
                 :.|.|     |.|....       .:|:..:..:...||:......:..|:.|.....|:
Mouse   331 -----DPPPP-----PRTGLIP-------GDHAPLAQGSKELTTSLVNQWPSLSTLHRPEGASNS 378

  Fly   375 N-HNSNSNSSTNPTVEAATLRSPS--MLSLSATSTPTASPAPSPTPS--------HSIASTSSAA 428
            . :..:|..||.|....|:|.|.|  :........|.......||||        .||.|..|.|
Mouse   379 KLYRRHSFMSTEPLSAEASLSSDSQRLGEAKRDEEPWGPIGKDPTPSMLGLCGSLASIPSCKSLA 443

  Fly   429 TSSTN 433
            :..:|
Mouse   444 SFKSN 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6051NP_001097943.1 FYVE_LST2 902..966 CDD:277270
Rundc3aXP_006533751.1 RUN 60..197 CDD:367169 25/120 (21%)
UPF0242 <266..>329 CDD:369080 13/66 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839963
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.