DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6051 and plekhf1

DIOPT Version :9

Sequence 1:NP_001097943.1 Gene:CG6051 / 43271 FlyBaseID:FBgn0039492 Length:989 Species:Drosophila melanogaster
Sequence 2:NP_956634.1 Gene:plekhf1 / 393311 ZFINID:ZDB-GENE-040426-1289 Length:293 Species:Danio rerio


Alignment Length:163 Identity:46/163 - (28%)
Similarity:68/163 - (41%) Gaps:31/163 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   830 LEQQQQQ---------QQLQIQLQRQRNNSVGSNTPSSASSTSSSSEQNSPVSARSGSRRRLQSN 885
            ||:.||:         .|..|:..| ::..|.:.:|....:.....||...:..::......:|.
Zfish    82 LEEVQQEDLEDGMAMANQWLIRTPR-KSFYVSAESPEEKIAWMGHIEQYRTLHVKNKGLPAKKSG 145

  Fly   886 NETQMPSSATSTSATLSPPAWIPDGKAPRCMACQTPFTAFRRRHHCRNCGGVFCGVCSNASAPLP 950
            ::...|              ||||..:..||.|...||...||||||.||.:.|..||...|.||
Zfish   146 DDFATP--------------WIPDVASAICMRCSKRFTVANRRHHCRRCGYIVCQACSKGRAVLP 196

  Fly   951 KYGLTKAVRVCRDCY------VREVRSGMGVQG 977
            ... .:.|||||:|.      :|:|:..|..:|
Zfish   197 HIS-NRPVRVCRNCKNDMTDGMRQVQGKMRAKG 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6051NP_001097943.1 FYVE_LST2 902..966 CDD:277270 29/69 (42%)
plekhf1NP_956634.1 PH_Phafin2-like 7..129 CDD:269927 10/47 (21%)
PH 39..128 CDD:278594 9/46 (20%)
PHD_SF 151..209 CDD:304600 29/72 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170584068
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.