DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6051 and rundc3ab

DIOPT Version :9

Sequence 1:NP_001097943.1 Gene:CG6051 / 43271 FlyBaseID:FBgn0039492 Length:989 Species:Drosophila melanogaster
Sequence 2:NP_956443.1 Gene:rundc3ab / 393118 ZFINID:ZDB-GENE-040426-842 Length:428 Species:Danio rerio


Alignment Length:416 Identity:85/416 - (20%)
Similarity:136/416 - (32%) Gaps:124/416 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 EEVLQENLAGQ-LWFGAE------CLAAGSSIMNRETESKE-MRPLAQAVTKSLGNVRVLLRDQC 145
            |.:|.....|. .||..:      ...|.|.:.|....|.| |..:..:..|....:||.|.::.
Zfish    66 EHILSHRFKGSGSWFDGQRSFWDFIRLACSKVPNNCISSIENMENINSSRAKGRAWLRVALMEKR 130

  Fly   146 LKNNVPNSKTLHLDLNDS-TTEQLYESLKIFDRLFAEFELSYVSAMVQVKSRHEYEMQQWIGVLF 209
            |...:..:      |.|| ||.:.|:...|..|    .|.:.::.|:             || |.
Zfish   131 LSEYIATA------LRDSRTTRRFYDEGAIMLR----EEATVLTGML-------------IG-LG 171

  Fly   210 SETLQRALKIGLLD--QEMVDAFDPGLMFSIPRLAIVAGLVVYAKGPLNMDMPG---------DQ 263
            :......||...||  .|.|..:.|.|.|:            .:...|:.|..|         |.
Zfish   172 AIDFSFCLKGEALDGKSEAVIDYTPYLKFT------------QSYDYLSDDEDGQSVDSSNSDDS 224

  Fly   264 LSEMFRP-------FRTILIKIRDLLRNLNNQELYQLEKLLCTNED-------INTKVPLGSSSI 314
            :...:.|       :|....|:....:.:|.|:.| ||:|:...|.       .|.|:..|...:
Zfish   225 VEHPYIPLVTDEESWRNKCRKMEQRFKIVNAQKGY-LEELVRLRESQLKNVEMENKKLTAGLEEL 288

  Fly   315 EAPSPEH---------------------SSHPTTS-----------SSQNNNNSSNNN--HSSSS 345
            :..|.:.                     .|||.:.           |.||.||..::.  |..|.
Zfish   289 QQQSQKEKGELENIILELQEQLTSLIPGESHPLSKDLSIPLVNQWPSLQNYNNQEDSKLYHRGSF 353

  Fly   346 TNTTSTTTTTAGTTNTHRTVERLVDQRNNNHNSNSNSSTNPTVEAATLRSPSMLSL--SATSTPT 408
            .:.....:.|.|:..|         :|..|..|...:..:.|        ||||.|  |.:|.|:
Zfish   354 PSPEPHISLTTGSQRT---------ERKQNGKSWCTAEKDYT--------PSMLGLCGSMSSLPS 401

  Fly   409 ASPAPSPTPSHSIASTSSAATSSTNP 434
            ....||...:..:.:.|:..:.:..|
Zfish   402 CKSLPSLRSTECLVNISAEPSPALTP 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6051NP_001097943.1 FYVE_LST2 902..966 CDD:277270
rundc3abNP_956443.1 RUN 60..181 CDD:280855 30/138 (22%)
YlqD 233..>313 CDD:287979 13/80 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 349..375 6/34 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170584066
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.