DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6051 and fab1

DIOPT Version :9

Sequence 1:NP_001097943.1 Gene:CG6051 / 43271 FlyBaseID:FBgn0039492 Length:989 Species:Drosophila melanogaster
Sequence 2:NP_611269.1 Gene:fab1 / 37033 FlyBaseID:FBgn0028741 Length:1809 Species:Drosophila melanogaster


Alignment Length:316 Identity:79/316 - (25%)
Similarity:127/316 - (40%) Gaps:73/316 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   703 NMSTAQEEIDIPEKTKESELFEFRASENDVIQESAGSNQSIYSAEEVNPELDNVFSAGGGNQATG 767
            |.|::.:.:..|     |:|.||..:..|       ..:|::.  .|..::.||::         
  Fly     7 NNSSSHQHLHSP-----SKLTEFARNFED-------KPESLFG--RVVNKIQNVYN--------- 48

  Fly   768 QRHSAGASMQRNNTIDLASQPGEGSPSGATTATSRSHVTRSRSLGDQEAASSATSSTAQLRQLEQ 832
                     |..||::..|       ||:::::|...|   :.:|..:..|.:.:|||::..:|.
  Fly    49 ---------QSYNTVNDIS-------SGSSSSSSTQPV---QVVGKSQFFSDSQTSTAEIADVET 94

  Fly   833 QQQQQ-------QLQIQLQRQ-RNNSVGSNTPSSASSTSSSSEQNSPVSARSGSRRRLQSN---- 885
            ..|..       .|.|:...: |..|..|||.:..|.||...| ..|:.....::.|..||    
  Fly    95 SSQSSVRPQPPTTLSIRTNSETRGTSTSSNTAAEDSETSDRVE-TLPLPTSEANQGRTVSNVLKH 158

  Fly   886 ----NETQMPSSATSTSATLSPPAWIPDGKAPRCMACQTPFTAFRRRHHCRNCGGVFCGVCSNAS 946
                ..|:..:...:...|.....|:||.||..|..|...|:.|||:||||.||.:||..|.|..
  Fly   159 ISNIVATKNNNDLRNYKDTELQRFWMPDSKAKECYDCSQKFSTFRRKHHCRLCGQIFCSKCCNQV 223

  Fly   947 APLPKYGLTKAVRVCRDC------YVREVRSGMGVQGVQSVQ-------SVQASAS 989
            .|.........::||..|      :::...|.|| |.:|.:|       .||.|.|
  Fly   224 VPGMIIRCDGDLKVCNYCSKIVLTFLKSSSSEMG-QDMQELQQHLSNKLEVQDSGS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6051NP_001097943.1 FYVE_LST2 902..966 CDD:277270 25/69 (36%)
fab1NP_611269.1 FYVE_PIKfyve_Fab1 182..243 CDD:277264 25/60 (42%)
DEP 329..397 CDD:214489
Fab1_TCP 464..717 CDD:239450
PIPKc 1413..1797 CDD:295374
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I3266
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2108
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.