DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6051 and rush

DIOPT Version :9

Sequence 1:NP_001097943.1 Gene:CG6051 / 43271 FlyBaseID:FBgn0039492 Length:989 Species:Drosophila melanogaster
Sequence 2:NP_001284784.1 Gene:rush / 31105 FlyBaseID:FBgn0025381 Length:316 Species:Drosophila melanogaster


Alignment Length:86 Identity:39/86 - (45%)
Similarity:50/86 - (58%) Gaps:5/86 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   906 WIPDGKAPRCMAC-QTPFTAFRRRHHCRNCGGVFCGVCSNASAPLPKYGLTKAVRVCRDCY--VR 967
            |:||..|..||.| :|.||..:|||||||||.|.|..||.....||:.. |||:|||..||  ::
  Fly   149 WVPDTDASVCMHCKKTQFTFIQRRHHCRNCGAVVCAGCSAKKFLLPQQS-TKALRVCDACYERLK 212

  Fly   968 EVRSGMGVQGVQSVQSVQASA 988
            .|.|.:| .|..|..:..|::
  Fly   213 HVPSSLG-SGEDSAAATGAAS 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6051NP_001097943.1 FYVE_LST2 902..966 CDD:277270 33/62 (53%)
rushNP_001284784.1 PH_Phafin2-like 7..129 CDD:269927
PH 39..131 CDD:278594
FYVE_PKHF 148..208 CDD:277257 31/59 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454072
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1089
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.