DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6051 and Plekhf1

DIOPT Version :9

Sequence 1:NP_001097943.1 Gene:CG6051 / 43271 FlyBaseID:FBgn0039492 Length:989 Species:Drosophila melanogaster
Sequence 2:NP_001013166.1 Gene:Plekhf1 / 308543 RGDID:1310544 Length:279 Species:Rattus norvegicus


Alignment Length:114 Identity:46/114 - (40%)
Similarity:54/114 - (47%) Gaps:16/114 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   858 SASSTSSSSEQNSPVSARSGSRRRLQSNNETQMPSSATSTSATLSPPA-WIPDGKAPRCMAC-QT 920
            ||:||:...|..|.:  ....||:|          .||....|....| ||||.....||.| ||
  Rat   112 SAASTTERQEWISHI--EECVRRQL----------LATGRQPTTEHAAPWIPDKATDICMRCTQT 164

  Fly   921 PFTAFRRRHHCRNCGGVFCGVCSNASAPLPKYGLTKAVRVCRDCYVREV 969
            .|:|..||||||.||.|.|..||.....||:.. .|.:|||..|| ||:
  Rat   165 RFSALTRRHHCRKCGFVVCAECSRERFLLPRLS-PKPLRVCSLCY-REL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6051NP_001097943.1 FYVE_LST2 902..966 CDD:277270 31/65 (48%)
Plekhf1NP_001013166.1 PH_Phafin2-like 7..129 CDD:269927 6/18 (33%)
PH 39..131 CDD:278594 6/20 (30%)
FYVE_PKHF1 148..211 CDD:277293 32/64 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..264
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343809
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.