DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6051 and Rundc3a

DIOPT Version :9

Sequence 1:NP_001097943.1 Gene:CG6051 / 43271 FlyBaseID:FBgn0039492 Length:989 Species:Drosophila melanogaster
Sequence 2:NP_942053.2 Gene:Rundc3a / 303569 RGDID:735057 Length:454 Species:Rattus norvegicus


Alignment Length:443 Identity:84/443 - (18%)
Similarity:147/443 - (33%) Gaps:130/443 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 IMEELLGEDRDPRAFRAKFPEEVLQENLAGQL-WFGAE--------CLAAGSSIMNRETESKE-M 123
            |:|::|.     ..|:|..|        ||.: ||.::        ...|.|.:.|....|.| |
  Rat    64 ILEQILS-----HRFKACAP--------AGPVSWFSSDGQRGFWDYIRLACSKVPNNCVSSIENM 115

  Fly   124 RPLAQAVTKSLGNVRVLLRDQCLKNNVPNSKTLHLDLNDS-TTEQLYESLKIFDRLFAEFELSYV 187
            ..::.|..|....:||.|.::.:...:..:      |.|: ||.:.|:|..|..|    .|.:.:
  Rat   116 ENISTARAKGRAWIRVALMEKRMSEYITTA------LRDNRTTRRFYDSGAIMLR----EEATVL 170

  Fly   188 SAMVQVKSRHEYEMQQWIGVLFSETLQRALKIGLLDQE--MVDAFDPGLMFS------------- 237
            :.|:...|..::..              .||..:||.:  :|..:.|.|.|:             
  Rat   171 TGMLIGLSAIDFSF--------------CLKGEVLDGKTPVVIDYTPYLKFTQSYDYLTDEEERH 221

  Fly   238 -------------IPRLAIVAG---------------LVVYA-KGPLN--MDMPGDQLSEMFRPF 271
                         .|.|.:|..               .:||| ||.|.  :.:...||.::....
  Rat   222 SAESSTSEDNSPEHPYLPLVTDEDSWYNKWHKMEQKFRIVYAQKGYLEELVRLRESQLKDLEAEN 286

  Fly   272 RTILIKIRDLLRNLNNQELYQLEKLLCTNED--------------INTKVPLGSSSIEAPSPEHS 322
            |.:.:::.:.... |.:|..:||.::...::              .....||...|.|..:...:
  Rat   287 RRLQLQLEEAAAQ-NQREKRELEGVILELQEQLPDPPPPPRTGLIPGDHAPLAQGSKELTTALVN 350

  Fly   323 SHPTTSSSQNNNNSSNN----NHSSSSTNTTSTTTTTAGTTNTHRTVERLVDQRNNNHNSNSNSS 383
            ..|:.|:......:||:    .||..||...|...:.:.            |.:...........
  Rat   351 QWPSLSTLSRPEGASNSKLFRRHSFMSTEPLSAEASLSS------------DSQRLGEGKRDEEP 403

  Fly   384 TNPTVEAATLRSPSMLSL--SATSTPTASPAPSPTPSHSIASTSSAATSSTNP 434
            ..|..:..|   ||||.|  |..|.|:.....|...:..:.|.|...:.:.:|
  Rat   404 WGPIGKDPT---PSMLGLCGSLASIPSCKSLASFKSNECLVSDSPEGSPALSP 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6051NP_001097943.1 FYVE_LST2 902..966 CDD:277270
Rundc3aNP_942053.2 RUN 60..186 CDD:397055 32/158 (20%)
UPF0242 <238..>318 CDD:399636 15/80 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343813
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.